close all open/close all

CDS information : Chalc_00120


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction15,562 / 14,645 / - [in whole cluster]
15,562 / 14,645 / - [in contig]
Locationcomplement(14645..15562) [in whole cluster]
complement(14645..15562) [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative TDP-glucose synthase
Gene
Gene (GenBank)chmAI
EC number2.7.7.24
Keyword
  • 6-deoxy-D-allose (D-mycinose)
  • D-chalcose
Note
Note (GenBank)
  • similar to DesIII
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331R2
PmId
[15179042] Cloning and expression of the glucose-1-phosphate thymidylyltransferase gene (gerD) from Streptomyces sp. GERI-155. (Mol Cells. , 2004)
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative TDP-glucose synthase]
MFETPLKRPGVRGIILAGGSATRLQPLTGALSKQQLPVYDKPMIYYPLSVLMLAGIQDIL
IISSHQHVETFQVMLGDGSRLGIQLDYAVQDEPRGVADAFLVGDKHIGNDRVALILGDNV
FHGPGFSTVLKHSLRRLDGCELFGYPSKSPERYGVAEIDEQGHLLSLEEKPSRPRSNLAV
TGLYFYDNDVVELAKDLKPSARGELEITDINLSYLEQGRARLTQLGRGFAWLDMGTHDSL
LQAGQYVQLLEQRQGVRIACLEEIALRMGFIDADTCYRLGEELSASSYGDYLMEVASGLG
ATRTG
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative TDP-glucose synthase]
GTGTTCGAGACACCGCTGAAACGCCCCGGAGTGAGGGGGATAATCCTCGCCGGGGGAAGC
GCCACTCGACTGCAGCCGCTGACCGGTGCGCTTTCCAAACAGCAGTTGCCCGTTTATGAC
AAACCCATGATCTATTATCCGCTGTCGGTGCTGATGCTGGCGGGAATCCAGGACATCCTC
ATCATCTCCTCGCACCAGCACGTGGAGACGTTCCAGGTCATGCTCGGCGACGGCTCGCGC
CTCGGTATCCAGCTCGACTACGCGGTCCAGGACGAGCCGCGCGGTGTCGCCGACGCGTTC
CTGGTCGGCGACAAGCACATCGGGAACGACCGGGTGGCGCTCATTCTGGGCGACAACGTC
TTCCACGGCCCCGGATTCTCCACCGTCCTGAAGCACTCCCTGCGACGTCTCGACGGATGT
GAACTGTTCGGCTATCCGTCCAAGTCGCCCGAGCGCTACGGCGTCGCCGAGATCGACGAG
CAGGGGCACCTGTTGTCCCTGGAGGAGAAGCCGAGCCGTCCTCGCTCCAACCTCGCCGTC
ACCGGGCTGTACTTCTACGACAACGACGTGGTGGAGCTGGCGAAGGACCTCAAGCCCTCA
GCCCGAGGCGAGTTGGAGATCACCGACATCAACCTGTCCTATCTGGAGCAGGGCCGCGCC
CGGCTGACCCAGCTCGGACGTGGATTCGCCTGGCTCGACATGGGAACCCACGACTCCCTG
CTCCAGGCGGGTCAGTACGTCCAGCTCCTCGAGCAGCGCCAGGGCGTACGCATCGCCTGT
CTCGAGGAGATCGCGCTGCGCATGGGCTTCATCGACGCGGACACCTGTTACCGGCTGGGT
GAGGAGCTGAGCGCCTCCAGCTACGGGGACTACCTCATGGAGGTCGCCTCGGGACTCGGG
GCGACGCGCACCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [13-247]  1.5e-62 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [12-296]  4.89999999999996e-127 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit