close all open/close all

CDS information : Chalc_00130


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction16,459 / 15,869 / - [in whole cluster]
16,459 / 15,869 / - [in contig]
Locationcomplement(15869..16459) [in whole cluster]
complement(15869..16459) [in contig]
TypeCDS
Length591 bp (196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxy-D-glucose 3-epimerase
Product (GenBank)putative 3-epimerase in D-allose pathway
Gene
Gene (GenBank)chmJ
EC number5.1.3.27
Keyword
  • 6-deoxy-D-allose (D-mycinose)
Note
Note (GenBank)
  • similar to TylJ
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
[23116432] Structural and functional studies on a 3'-epimerase involved in the biosynthesis of dTDP-6-deoxy-D-allose. (Biochemistry. , 2012)
Related Reference
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 3-epimerase [putative 3-epimerase in D-allose pathway]
MHPLSIEGAWSQEPVIHSDHRGRSHEWFRGESFRQAFGHDFPVAQVNVAVSHRGALRGIH
YTEIPPGQAKYSVCVRGAGLDVVVDVRIGSPTFGRWEIVPMDAERNTAVYLTAGLGRAFL
SLTDDATLVYLCSSGYAPAREHSVNPLDPDLGIAWPDDIEPLLSDRDENAPTLATAERLG
LLPTYQAWQEQQQAQR
selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 3-epimerase [putative 3-epimerase in D-allose pathway]
ATGCATCCACTCAGCATCGAGGGGGCCTGGTCGCAGGAACCCGTCATCCACTCCGACCAC
CGCGGGAGGTCCCACGAGTGGTTCCGGGGCGAGAGCTTCCGTCAGGCGTTCGGCCATGAC
TTCCCGGTGGCCCAGGTCAATGTCGCGGTGTCGCACCGCGGCGCGCTGCGCGGGATCCAC
TACACCGAGATCCCGCCAGGTCAGGCCAAGTACAGCGTGTGCGTGCGGGGAGCCGGCCTC
GACGTCGTCGTGGACGTCCGCATCGGTTCGCCGACCTTCGGGCGCTGGGAGATCGTGCCC
ATGGACGCGGAACGCAACACCGCCGTCTATCTGACCGCGGGACTGGGCCGTGCCTTCCTC
TCCCTCACCGACGACGCCACGCTCGTCTACCTCTGCTCCTCCGGATACGCTCCCGCACGC
GAGCACTCCGTCAATCCGCTCGACCCCGACCTCGGAATCGCGTGGCCGGACGACATCGAG
CCGCTGCTCTCCGACAGGGACGAGAACGCCCCGACCCTCGCGACGGCCGAACGGCTCGGT
CTGCTGCCGACCTATCAGGCCTGGCAGGAACAGCAACAGGCGCAGAGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [4-180]  PD001462
PD001462   dTDP_sugar_isom
 [2-175]  2.4e-51 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-180]  6.10002656149838e-64 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [2-187]  1.09999999999999e-57 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit