close all open/close all

CDS information : Chalc_00140


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction17,290 / 16,523 / - [in whole cluster]
17,290 / 16,523 / - [in contig]
Locationcomplement(16523..17290) [in whole cluster]
complement(16523..17290) [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative hexose C-3'' O-methyltransferase
Product (GenBank)putative 3'OH-methyltransferase in D-mycinose pathway
GenechmMII
chmF
Gene (GenBank)chmMII
EC number2.1.1.-
Keyword
  • D-mycinose
Note
Note (GenBank)
  • member of O-methyltransferase homology family, including TylF
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q49492
PmId
[8163162] A gene encoding mycinamicin III O-methyltransferase from Micromonospora griseorubida. (Gene. , 1994)
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)
[20158522] Gene targeting for O-methyltransferase genes, mycE and mycF, on the chromosome of Micromonospora griseorubida producing mycinamicin with a disruption cassette containing the bacteriophage phi C31 attB attachment site. (FEMS Microbiol Lett. , 2010)
[25692963] Structural basis of substrate specificity and regiochemistry in the MycF/TylF family of sugar O-methyltransferases. (ACS Chem Biol. , 2015)
ACC
Q9ALM9
NITE
Spino_00140
PmId
[20158237] Biosynthesis of spinosyn in Saccharopolyspora spinosa: synthesis of permethylated rhamnose and characterization of the functions of SpnH, SpnI, and SpnK. (J Am Chem Soc. , 2010)

close this sectionSequence

selected fasta
>putative hexose C-3'' O-methyltransferase [putative 3'OH-methyltransferase in D-mycinose pathway]
MTVIAAEADLYLDLLKKVVTNMIYEDQTNVAGLITSSSYSAELRSVGEDFPRVAHSMVGL
KRLDNLQKCLEDVLRDGVPGDFAETGVWRGGACIFARGVFRAHGVRDRKVWVADSFQGFP
KTTEDDHQLDVDIDLGQYNDVLSIPVDVETVKGNFARYGLLDDQVRFLPGWFKDTMPTAP
IERLAVLRLDGDSYAATREVLTNLYHKVSDGGYVIVDDYCIPACRQAVHEFRDEHGITDE
IHQIDRQGSYWRRSS
selected fasta
>putative hexose C-3'' O-methyltransferase [putative 3'OH-methyltransferase in D-mycinose pathway]
ATGACTGTCATAGCTGCCGAAGCGGACCTGTATCTCGACCTTCTGAAGAAGGTCGTGACG
AACATGATTTACGAGGACCAGACCAATGTCGCCGGCCTCATCACCAGCAGCTCGTATTCC
GCGGAACTGCGCTCGGTGGGTGAGGACTTTCCGCGCGTGGCGCACTCGATGGTCGGTCTC
AAGCGGCTCGACAACCTGCAGAAGTGCCTGGAGGACGTGCTGCGCGACGGCGTGCCGGGG
GACTTCGCGGAGACCGGGGTCTGGCGGGGCGGGGCCTGCATCTTCGCCCGCGGCGTCTTC
CGGGCGCACGGCGTGCGGGACCGGAAGGTGTGGGTCGCGGACTCCTTCCAGGGTTTCCCC
AAGACCACCGAGGACGACCACCAGCTGGACGTCGACATCGACCTCGGCCAGTACAACGAC
GTCCTCAGCATCCCGGTCGACGTGGAGACCGTGAAGGGGAACTTCGCGCGCTACGGACTC
CTGGACGACCAGGTCCGCTTCCTCCCGGGCTGGTTCAAGGACACGATGCCCACCGCGCCC
ATCGAGAGGCTCGCGGTGCTGAGGCTCGACGGGGACTCGTACGCAGCCACCAGGGAGGTT
CTCACCAACCTCTACCACAAGGTGTCGGACGGCGGGTACGTCATCGTCGACGACTACTGC
ATTCCGGCGTGCCGGCAGGCCGTCCACGAGTTCCGGGACGAGCACGGCATCACGGACGAG
ATCCACCAGATCGATCGCCAGGGTTCCTACTGGAGACGCTCCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [6-254]  4.89999999999996e-128 PF05711
PF05711   TylF
SignalP No significant hit
TMHMM No significant hit