close all open/close all

CDS information : Chalc_00150


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction17,551 / 18,813 / + [in whole cluster]
17,551 / 18,813 / + [in contig]
Location17551..18813 [in whole cluster]
17551..18813 [in contig]
TypeCDS
Length1,263 bp (420 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450
Gene
Gene (GenBank)chmHI
EC number
Keyword
  • C-20 hydroxylate
Note
Note (GenBank)
  • putative macrolide C20-hydroxylase; similar to TylF
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
[15489173] Production of hybrid 16-membered macrolides by expressing combinations of polyketide synthase genes in engineered Streptomyces fradiae hosts. (Chem Biol. , 2004)
Related Reference
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>cytochrome P450 [P450]
MLDVDHLLPIAFRVRKSMKSSKVVHSRPAEAGVAWPVARTCPFTLPDQYAEKRKNEPICR
AQVWDDSRTWLITKHEHVRALLADPRVTVDPAKLPRLSPSDGDGGGFRSLLTMDPPDHNA
LRRMLISEFSVHRVREMRPGIERTVHGLLDGILERRGPVDLVAELALPMSTLVICQLLGV
PYEDREFFQERSEQATRVGGSQESLTALLELRDYLDRLVTAKIETPGDDLLCRLIASRLH
TGEMRHAEIVDNAVLLLAAGHETSAAMVALGILTLLRHPGALAELRGDGTLMPQTVDELL
RFHSIADGLRRAVTEDIELGGITLRAGDGLIVSLASANRDESAFASPDGFDPHHPASRHV
AFGYGPHQCLGQNLARLELEVTLGAVVERIPTLRLAGDADALRVKQDSTIFGLHELPVEW
selected fasta
>cytochrome P450 [P450]
ATGTTGGACGTAGATCACCTTCTCCCGATTGCATTCAGGGTGAGGAAATCCATGAAATCT
TCAAAAGTCGTTCACAGCCGTCCTGCGGAAGCGGGCGTCGCATGGCCCGTCGCGCGAACC
TGCCCCTTTACGCTCCCTGATCAGTACGCAGAGAAGCGCAAGAACGAGCCCATATGCCGG
GCTCAGGTCTGGGACGACTCCAGAACCTGGCTCATCACCAAGCACGAGCACGTACGAGCC
CTTCTCGCCGACCCCCGGGTCACCGTCGACCCGGCCAAGCTGCCCAGGCTCTCCCCCTCC
GACGGCGACGGCGGCGGCTTCCGGTCCCTGCTGACCATGGACCCCCCGGACCACAACGCC
CTCCGCCGCATGCTCATATCCGAGTTCAGCGTGCACCGGGTCCGGGAGATGCGCCCGGGC
ATCGAGCGCACCGTGCACGGGCTGCTGGACGGGATCCTCGAACGGCGGGGGCCGGTGGAC
CTGGTGGCCGAACTCGCGCTGCCGATGTCCACCCTGGTGATCTGTCAGCTCCTCGGAGTG
CCCTACGAAGACCGCGAGTTCTTCCAGGAACGCAGCGAACAGGCCACCCGGGTGGGCGGG
AGCCAGGAATCGCTGACCGCGCTCCTGGAACTACGGGACTACCTGGACCGGTTGGTCACC
GCGAAGATCGAGACGCCGGGTGACGACCTGCTGTGCCGGCTCATCGCCAGTCGACTGCAC
ACCGGTGAGATGCGACACGCCGAGATCGTGGACAACGCCGTGCTGCTGCTCGCCGCCGGC
CACGAGACCAGTGCCGCCATGGTGGCACTGGGCATCCTGACACTGTTGCGGCACCCCGGC
GCCCTGGCGGAGTTGCGGGGCGACGGTACGCTGATGCCGCAGACGGTCGACGAACTCCTG
CGTTTCCACTCCATCGCGGACGGCCTTCGACGGGCGGTCACGGAGGACATCGAACTCGGC
GGCATCACGCTGCGCGCCGGAGACGGCCTCATCGTCTCGCTGGCCTCCGCCAACCGCGAC
GAGAGCGCCTTCGCCTCCCCGGACGGCTTCGACCCGCACCATCCGGCGAGCCGGCACGTC
GCCTTCGGCTACGGCCCCCACCAGTGCCTGGGCCAGAACCTGGCCCGGCTGGAGCTGGAG
GTCACCCTGGGCGCGGTGGTGGAGCGCATTCCCACGCTCAGGCTGGCCGGCGACGCCGAC
GCACTGCGCGTCAAACAGGATTCGACCATCTTCGGGCTGCACGAGCTGCCGGTCGAGTGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [259-276]  2.59999946718995e-08 PR00385 [294-305]  2.59999946718995e-08 PR00385 [360-369]  2.59999946718995e-08 PR00385 [369-380]  2.59999946718995e-08 PR00385
PR00385   P450
 [229-389]  3.09999999999998e-29 PF00067
PF00067   p450
 [18-420]  7.40000780398351e-96 SSF48264
SSF48264   Cytochrome_P450
 [39-420]  2.99999999999998e-104 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [113-124]  7.30000590915205e-54 PR00359 [160-176]  7.30000590915205e-54 PR00359 [177-192]  7.30000590915205e-54 PR00359 [213-235]  7.30000590915205e-54 PR00359 [294-305]  7.30000590915205e-54 PR00359 [311-338]  7.30000590915205e-54 PR00359 [339-354]  7.30000590915205e-54 PR00359 [360-369]  7.30000590915205e-54 PR00359 [369-380]  7.30000590915205e-54 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [362-371]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-31]  0.433 Signal
Bacteria, Gram-positive   
 [1-31]  0.254 Signal
Bacteria, Gram-negative   
TMHMM No significant hit