close all open/close all

CDS information : Chalc_00160


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction18,831 / 19,052 / + [in whole cluster]
18,831 / 19,052 / + [in contig]
Location18831..19052 [in whole cluster]
18831..19052 [in contig]
TypeCDS
Length222 bp (73 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)ferredoxin
Gene
Gene (GenBank)chmHII
EC number
Keyword
Note
Note (GenBank)
  • similar to TylHII
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
B3XWK4
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)
ACC
P46797
PmId
[8168477] Sequence, assembly and evolution of a primordial ferredoxin from Thermotoga maritima. (EMBO J. , 1994)
[8939753] Small structural changes account for the high thermostability of 1[4Fe-4S] ferredoxin from the hyperthermophilic bacterium Thermotoga maritima. (Structure. , 1996)
[8647119] An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin. (Eur J Biochem. , 1996)

close this sectionSequence

selected fasta
>putative ferredoxin [ferredoxin]
MRVTVDQSRCLGAGQCEQLAPEVFRQDEEGLSRVLVPEPDPASWPRVLQTVDLCPVQAVL
IDEGPGPAPQDTK
selected fasta
>putative ferredoxin [ferredoxin]
GTGCGGGTGACAGTCGACCAGAGCCGGTGCCTGGGAGCCGGCCAGTGCGAGCAGCTGGCG
CCGGAGGTCTTCCGCCAGGACGAGGAAGGACTGAGCCGGGTCCTCGTCCCCGAGCCCGAT
CCGGCGTCATGGCCGCGGGTGCTCCAGACGGTGGACCTCTGCCCCGTACAGGCCGTCCTC
ATCGACGAGGGCCCCGGTCCCGCGCCGCAGGACACCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  3.49999851148921e-06 PR00352 [16-26]  3.49999851148921e-06 PR00352 [47-59]  3.49999851148921e-06 PR00352
PR00352   3FE4SFRDOXIN
IPR017896 4Fe-4S ferredoxin-type, iron-sulpur binding domain (Domain)
 [1-29]  PS51379
PS51379   4FE4S_FER_2
SignalP No significant hit
TMHMM No significant hit