close all open/close all

CDS information : Chalc_00170


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction19,049 / 20,029 / + [in whole cluster]
19,049 / 20,029 / + [in contig]
Location19049..20029 [in whole cluster]
19049..20029 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-keto-6-deoxy-D-allose C-4 ketoreductase
Product (GenBank)putative 4-ketoreductase in D-allose pathway
Gene
Gene (GenBank)chmD
EC number
Keyword
  • 6-deoxy-D-allose (D-mycinose)
Note
Note (GenBank)
  • similar to TylD and MydI
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331Q7
PmId
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>putative dTDP-4-keto-6-deoxy-D-allose C-4 ketoreductase [putative 4-ketoreductase in D-allose pathway]
MTADRWAGRTVLVTGALGFIGSHFVRQLEARGAEVLALYRTERPQLQAELAALDRVRLIR
TELRDESDVRGAFKYLAPSIDTVVHCAAMDGNAQFKLERSAEILDSNQRTISHLLNCVRD
FGVGEAVVMSSSELYCAPPTAAAHEDDDFRRSMRYTDNGYVLSKTYGEILARLHREQFGT
NVFLVRPGNVYGPGDGYDPSRGRVIPSMLAKADAGEEIEIWGDGSQTRSFIHVTDLVRAS
LRLLETGKYPEMNVAGAEQVSILELARMVMAVLGRPERIRLDPGRPVGAPSRLLDLTRMS
EVIDFEPQPLRTGLEETARWFRHHTR
selected fasta
>putative dTDP-4-keto-6-deoxy-D-allose C-4 ketoreductase [putative 4-ketoreductase in D-allose pathway]
GTGACCGCTGACCGCTGGGCCGGCCGCACGGTGCTCGTCACGGGAGCACTCGGGTTCATC
GGCTCCCACTTCGTCCGACAGCTGGAGGCGCGCGGAGCCGAGGTGCTCGCCCTCTACCGC
ACCGAACGGCCGCAATTACAGGCCGAGTTGGCCGCGCTCGACCGAGTACGCCTGATCAGG
ACGGAGCTGCGGGACGAGTCGGACGTGCGAGGGGCCTTCAAGTACCTGGCACCCTCCATC
GACACCGTCGTCCACTGCGCGGCCATGGACGGCAACGCGCAGTTCAAGCTGGAGCGCTCG
GCCGAGATCCTCGACAGCAACCAGCGGACCATCTCCCACCTGCTGAACTGCGTACGGGAC
TTCGGCGTCGGCGAGGCCGTGGTCATGAGCTCCTCCGAGCTGTACTGCGCGCCGCCCACC
GCGGCGGCCCACGAGGACGACGACTTCCGCCGATCCATGCGGTACACGGACAACGGCTAC
GTCCTGTCCAAGACCTACGGCGAGATCCTGGCCAGGCTCCACCGCGAGCAGTTCGGCACC
AACGTCTTCCTGGTGCGACCGGGCAACGTCTACGGGCCGGGAGACGGCTACGACCCCTCC
CGGGGCCGGGTGATCCCCAGCATGCTGGCCAAGGCCGACGCCGGCGAGGAGATAGAGATC
TGGGGGGACGGCAGTCAGACCCGGTCCTTCATCCACGTCACCGACCTGGTACGGGCCTCA
CTGCGCCTGCTGGAGACCGGCAAGTACCCCGAGATGAACGTGGCCGGCGCGGAACAGGTC
TCCATCCTGGAGCTCGCCCGGATGGTGATGGCCGTCCTGGGACGGCCCGAGCGCATCCGC
CTCGACCCCGGCCGCCCCGTCGGCGCCCCGAGCAGACTTCTGGATCTGACCAGGATGTCG
GAAGTGATCGACTTCGAGCCCCAGCCCCTGCGGACCGGGCTGGAAGAGACCGCTCGCTGG
TTCCGCCACCACACGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [11-254]  2.70000000000002e-50 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [7-195]  5.30000000000001e-43 G3DSA:3.40.50.720 [240-274]  5.30000000000001e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-30]  0.79 Signal
Eukaryota   
 [1-30]  0.144 Signal
Bacteria, Gram-positive   
TMHMM No significant hit