close all open/close all

CDS information : Chalc_00180


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction20,062 / 21,273 / + [in whole cluster]
20,062 / 21,273 / + [in contig]
Location20062..21273 [in whole cluster]
20062..21273 [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative hexose C-2'' O-methyltransferase
Product (GenBank)putative 2'OH-methyltransferase in D-mycinose pathway
GenechmMI
chmE
Gene (GenBank)chmMI
EC number2.1.1.-
Keyword
  • D-mycinose
Note
Note (GenBank)
  • member of O-methyltransferase homology family, including TylD and MydI
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q83WF2
PmId
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative hexose C-2'' O-methyltransferase [putative 2'OH-methyltransferase in D-mycinose pathway]
MVTHAPNSLISDIIRASGGHDADLKDLAARHDPADIVRVLLDEITSRCPAPVNDVPVLVE
LAVRAGDRLFPTYLYVLKGGPVRLAAKDEAFVAMRVEYELGELARELFGPVRENVTGVRG
TTLFPYVGDTASEGEEDSGAEHIGTHFLAAQQGSQTVLAGCHSHKPDLSELSSRYLTPKW
GSLHWFTPHYDRHFRSYRDQPVRVLEIGIGGYKHPEWGGGSLRMWKHFFHRGEIYGLDIV
DKSHFDAPRITTLRGDQSDPDHLRSIAEKYGPFDIVIDDGSHINDHIRTSFQALFPHVRP
GGLYVIEDLWTAYWSGFGGDEDPKRYSGTSLGLLKSLVDSIQHEELPEAGDHRPSYADQH
VVGMHLYHNLAFIEKGTNAEGGIPPWIPRDFETLVAVSSGGHA
selected fasta
>putative hexose C-2'' O-methyltransferase [putative 2'OH-methyltransferase in D-mycinose pathway]
GTGGTCACACACGCCCCGAACTCGCTGATCAGTGACATAATCCGCGCCTCCGGCGGGCAT
GACGCCGACCTCAAGGACCTGGCCGCCCGACACGATCCGGCCGACATCGTCCGCGTACTC
CTGGACGAGATCACCTCACGCTGCCCCGCTCCCGTGAACGACGTCCCCGTCCTCGTCGAG
CTGGCCGTCCGGGCGGGAGACCGCCTCTTCCCCACCTATCTGTACGTCCTCAAGGGCGGC
CCGGTGCGCCTCGCGGCCAAGGACGAGGCGTTCGTCGCCATGCGCGTCGAGTACGAGCTG
GGCGAACTGGCCCGCGAGCTGTTCGGACCGGTGCGGGAGAACGTCACCGGCGTCCGCGGA
ACGACTCTCTTCCCCTACGTCGGGGACACGGCGTCGGAAGGCGAGGAGGACTCGGGTGCC
GAGCACATCGGCACGCACTTCCTGGCCGCGCAGCAGGGCTCCCAGACCGTGCTCGCCGGC
TGCCATTCCCACAAGCCGGACCTCAGCGAGCTCTCCTCGCGCTACCTCACCCCGAAGTGG
GGCTCGCTGCACTGGTTCACCCCCCACTACGACCGCCACTTCAGGAGCTACCGGGACCAG
CCCGTACGCGTTCTGGAGATCGGCATCGGCGGCTACAAGCACCCCGAGTGGGGCGGCGGC
TCCCTGCGCATGTGGAAGCACTTCTTCCATCGCGGCGAGATCTACGGCCTGGACATCGTC
GACAAGTCGCACTTCGACGCGCCGCGCATCACGACCCTGCGCGGCGACCAGAGCGACCCC
GACCACCTGCGGTCGATCGCCGAGAAGTACGGACCGTTCGACATCGTCATCGACGACGGA
AGCCACATCAACGACCACATCCGGACCTCGTTCCAGGCACTGTTCCCGCATGTGCGGCCC
GGCGGCCTCTACGTGATCGAGGACCTGTGGACCGCCTACTGGTCCGGCTTCGGCGGCGAC
GAGGACCCGAAGCGGTACAGCGGGACGAGCCTGGGCCTGCTCAAGTCCCTCGTCGACTCG
ATCCAGCACGAGGAACTGCCGGAGGCCGGCGACCACCGTCCCAGTTACGCGGACCAGCAC
GTGGTCGGCATGCACCTCTACCACAACCTGGCGTTCATCGAGAAGGGCACCAACGCCGAG
GGCGGCATCCCCCCGTGGATCCCACGCGACTTCGAGACCCTCGTCGCCGTCTCCTCCGGG
GGCCACGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit