close all open/close all

CDS information : Chalc_00190


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction21,329 / 22,585 / + [in whole cluster]
21,329 / 22,585 / + [in contig]
Location21329..22585 [in whole cluster]
21329..22585 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative D-allose glycosyltransferase
Gene
Gene (GenBank)chmN
EC number
Keyword
  • 6-deoxy-D-allose (D-mycinose)
Note
Note (GenBank)
  • similar to TylN, MycD
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331Q5
PmId
[20069384] Biosynthesis of dihydrochalcomycin: characterization of a deoxyallosyltransferase (gerGTI). (Mol Cells. , 2010)
ACC
O70023
PmId
[9651492] Characterization and targeted disruption of a glycosyltransferase gene in the tylosin producer, Streptomyces fradiae. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative D-allose glycosyltransferase]
MRVTLLSVGSRGDVQPFVALGIGLKARGHDVTLAAPATLRPLVERAGLTYRLSPGDPDGF
FTMPEVVEALRRGPSFKNMLAGMPEAPESYTQQVVDAIHDAAEGADLIVNAPLTLAAAYG
HPPAPWASVSWWPNSMTSAFPAVESGQRHLGPLTSLYNRYTHRRAARDEWEWRRPEIDGY
RRRLGLRPFGDESPFLRLGHDRPYLFPFSPSVLPKPRDWPRQSHVTGYWFWDQHGEPPAE
LESFLEDGEPPVALTFGSTWSLHRQEEALQAALDAVRGVGRRLVMVDGPDSDLPDDVLRL
HQVDYATLFPRMAAVIHHGGAGTTAEVLRAGVPQVIVPVFADHPFWAARLSRTGVAARPV
PFARFSREALAQSVRQAVTDPAMAGRARRLGERVSKERGVDTACDILEKWAETARATA
selected fasta
>putative glycosyltransferase [putative D-allose glycosyltransferase]
ATGCGCGTGACCCTGCTGAGCGTCGGATCCCGAGGCGACGTCCAGCCGTTCGTCGCCCTC
GGCATCGGCCTCAAGGCCCGCGGCCACGACGTCACCCTGGCCGCCCCCGCCACGCTGCGG
CCACTGGTCGAGCGCGCGGGACTGACGTACAGGCTGTCCCCCGGGGATCCCGACGGATTC
TTCACCATGCCCGAGGTCGTCGAAGCGCTGCGGCGCGGCCCCTCGTTCAAGAACATGCTC
GCGGGGATGCCCGAGGCGCCCGAGAGCTACACACAGCAGGTCGTCGACGCGATCCACGAC
GCCGCCGAGGGCGCCGACCTCATAGTGAACGCGCCCCTCACCCTGGCCGCCGCGTACGGG
CACCCGCCCGCCCCGTGGGCCTCGGTGTCCTGGTGGCCCAACAGCATGACCTCGGCCTTC
CCGGCCGTCGAATCCGGGCAGCGCCACCTCGGACCGCTGACGTCCCTGTACAACCGCTAC
ACCCATCGCAGGGCGGCACGCGACGAGTGGGAGTGGCGACGCCCCGAGATCGACGGCTAC
CGCCGACGCCTCGGCCTCCGGCCCTTCGGCGACGAGTCCCCGTTCCTCCGACTGGGGCAC
GACCGCCCGTACCTGTTCCCCTTCAGCCCCAGCGTGCTGCCCAAGCCGCGGGACTGGCCG
CGCCAGAGCCACGTCACCGGCTACTGGTTCTGGGACCAGCACGGGGAGCCGCCCGCCGAG
CTGGAGTCGTTCCTGGAGGACGGGGAGCCCCCGGTGGCGCTCACCTTCGGCAGCACCTGG
TCACTCCACCGGCAGGAGGAGGCCCTCCAGGCCGCCCTCGACGCCGTCCGTGGCGTCGGA
CGCCGACTGGTCATGGTCGACGGACCGGACAGCGACCTGCCCGACGACGTGCTCCGCCTG
CACCAGGTGGACTACGCCACCCTCTTCCCCAGGATGGCCGCGGTGATCCACCACGGCGGC
GCCGGCACGACCGCCGAGGTCCTCCGGGCCGGAGTGCCCCAGGTCATCGTGCCGGTCTTC
GCCGATCACCCCTTCTGGGCGGCTCGACTGTCCAGAACAGGCGTCGCCGCCCGGCCGGTC
CCCTTCGCCCGCTTCAGCCGAGAGGCACTGGCGCAGAGCGTCCGCCAGGCGGTCACCGAT
CCCGCGATGGCGGGCCGGGCCAGGCGACTGGGCGAACGGGTCTCCAAGGAACGGGGAGTG
GACACCGCCTGCGACATCCTCGAGAAGTGGGCGGAGACGGCACGCGCCACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [310-385]  1.5e-06 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-136]  4.29999999999999e-22 PF03033
PF03033   Glyco_transf_28
SignalP
 [1-34]  0.136 Signal
Eukaryota   
TMHMM No significant hit