close all open/close all

CDS information : Chalc_00200


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction23,495 / 22,653 / - [in whole cluster]
23,495 / 22,653 / - [in contig]
Locationcomplement(22653..23495) [in whole cluster]
complement(22653..23495) [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative 23S rRNA methyltransferase
Product (GenBank)putative resistance determinant
Gene
Gene (GenBank)chrB
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • member of predicted 23S-rRNA G748-methyltransferase family; similar to TlrB
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9S1M6
PmId
[10348045] Molecular analysis of tlrB, an antibiotic-resistance gene from tylosin-producing Streptomyces fradiae, and discovery of a novel resistance mechanism. (J Antibiot (Tokyo). , 1999)

close this sectionSequence

selected fasta
>putative 23S rRNA methyltransferase [putative resistance determinant]
MLNRIVRYLACPHCGASLAQGDRALFCPAGHSFDIAKQGYVNLLPRATKLRADTKEMVEA
RDAFLSAGHYDPVMDALVDLARRTADPAVPGCVVDIGGGTGHYHAGVMEAFPDAQGLLLD
ISKYAVRRAAKAHPRIAAAVTDAWQTLPLRDAAAGMVINTFAPRNGPELHRVLHPRGVLL
VVTPLPDHLREVIGALGLLQVDEGKESRLAEQLAPHFSAVATEELTRTMALDHQALAHLV
GMGPNAWHRDAQRDLETIQRLPAPTRVTLSVRLSAYRLSA
selected fasta
>putative 23S rRNA methyltransferase [putative resistance determinant]
ATGCTCAACAGGATCGTGCGCTACCTCGCCTGCCCGCACTGCGGTGCTTCGCTGGCTCAG
GGCGACCGCGCACTTTTCTGCCCCGCCGGACACTCCTTCGACATCGCGAAGCAGGGTTAT
GTGAATCTGCTTCCCAGGGCGACGAAGCTGCGGGCCGACACCAAGGAAATGGTGGAGGCC
CGGGACGCATTCCTGTCGGCGGGTCACTACGACCCCGTGATGGATGCGCTGGTCGATCTG
GCGCGGCGGACGGCCGATCCGGCCGTGCCCGGCTGTGTGGTCGACATCGGTGGGGGGACG
GGCCACTATCACGCCGGGGTCATGGAAGCGTTCCCCGATGCCCAGGGCCTGCTGCTGGAC
ATCTCCAAGTACGCCGTGCGGCGTGCCGCGAAGGCGCATCCGCGGATCGCGGCCGCGGTG
ACCGACGCCTGGCAGACGCTTCCGCTGCGGGATGCCGCAGCCGGCATGGTGATCAACACG
TTCGCTCCCCGCAACGGTCCTGAACTGCATCGCGTTCTCCATCCCCGTGGCGTTCTCCTG
GTTGTCACTCCTCTGCCCGATCACCTGCGGGAGGTGATCGGCGCCCTCGGCCTGCTGCAG
GTGGACGAAGGCAAGGAGTCGCGTCTCGCGGAGCAGCTCGCTCCGCACTTCTCGGCCGTC
GCCACGGAGGAGTTGACCCGGACCATGGCTCTCGACCACCAGGCTCTGGCGCACCTGGTC
GGCATGGGGCCCAATGCCTGGCACCGTGACGCGCAGCGGGATCTGGAGACGATCCAGCGG
CTGCCGGCGCCGACTCGGGTCACGCTCTCCGTGCGGCTCTCCGCCTACCGGTTGTCGGCG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [93-152]  2.8e-06 PF00891
PF00891   Methyltransf_2
IPR016718 rRNA (guanine-N1-)-methyltransferase A, predicted (Family)
 [1-280]  1.69998802370953e-108 PIRSF018249
PIRSF018249   MyrA_prd
SignalP
 [1-19]  0.445 Signal
Bacteria, Gram-negative   
TMHMM No significant hit