close all open/close all

CDS information : Chalc_00210


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction23,622 / 36,947 / + [in whole cluster]
23,622 / 36,947 / + [in contig]
Location23622..36947 [in whole cluster]
23622..36947 [in contig]
TypeCDS
Length13,326 bp (4,441 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase subunit
Gene
Gene (GenBank)chmGI
EC number
Keyword
Note
Note (GenBank)
  • modules 0-2 KSq/AT/ACP/KS/AT/KR/ACP/KS/AT/DH/KR/ACP
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
[15489173] Production of hybrid 16-membered macrolides by expressing combinations of polyketide synthase genes in engineered Streptomyces fradiae hosts. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

0 malonyl-CoA
not conserved HAFHS,
conserved signature for methylmalonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
not conserved HAFHS,
conserved signature for methylmalonyl-CoA
KSQ68..420
AT580..896
ACP972..1042
KS1062..1438
AT1591..1907
KR2179..2354
ACP2457..2531
KS2559..2934
AT3092..3408
DH3458..3624
KR3972..4152
ACP4273..4343

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase subunit]
MRAPYGNRQVNRRFLREFRAKRPHCVSPLHFLAEFSESRQTTGSAGVTAPIDRPGVSMAP
KSGAQRSSDIAVVGMSCRLPGAPGIDEFWHLLTTGGSAIERRADGTWRGSLDGAADFDAA
FFDMTPRQAAAADPQQRLMLELGWTALENAGIVPGSLAGTDTGVFVGIAADDYAALLHRS
ATPVSGHTATGLSRGMAANRLSYLLGLRGPSLAVDSAQSSSLVAVHLACESLRRGESDLA
IVGGVSLILAEDSTAGMELMGALSPDGRCHTFDARANGYVRGEGGACVVLKPLERALADG
DRVHCVVRGSAVNNDGGGSTLTTPHREAQAAVLRAAYERAGVGPDQVSYVELHGTGTPVG
DPVEAAALGAVLGTAHGRNAPLSVGSVKTNVGHLEAAAGLVGFVKAALCVREGVVPPSLN
HATPNPAIPMDRLNLRVPTRLEPWPHPDDRATGRLRLAGVSSFGMGGTNAHVVVEEAPLP
EAGEPVGAGVPLAVVPVVVSGRSAGAVAELASRLNESVRSDRLVDVGLSSVVSRSVFEHR
SVVLAGDSAELSAGLDALAADGVSPVLVSGVASVGGGRSVFVFPGAGVKWAGMALGLWAE
SAVFAESMARCEAAFAGLVEWRLADVLGDGAALEREDVVQPASFAVMVSLAALWRSLGVV
PDAVVGHSQGEIAAAVVAGGLSLEDGARVVVLRARVAEEVLSGGGIASVRLSRAEVEERL
AGGGGGLSVAVVNAPSSTVVAGELGDLDRFVAACEAEGVRARRLEFGYASHSRFVEPVRE
RLLEGLADVRPVRGRIPFYSTVEAAEFDTAGLDAEYWFGNLRRPVRFQETVERLLADGFR
VFVECGAHPVLTGAVQETAETAGREICSVGSLRRDEGGLRRFLTSAAEAFVQGVEVSWPV
LFDGTGARTVDLPTYPFQRRHHWAPDGSASAAPTRDIRPDETAAVPADTMDLAGQLRADV
ASLPTTEQIARLLDQVRDGVATVLGLDARDEVRAEATFKELGVESLTGVELKNHLRARTG
LHVPTSLIYDCPTPLAAAHYLRDELLGRPAEQAVVPAGIPVDEPIAIVGMGCRLPGGVSS
PEGLWDLVASGVDAVSPFPTDRGWDVGGLFDPEPGVPGRSYVREGGFLHEAGEFDAGFFG
ISPREALAMDPQQRLLLETSWEALERAGIDPHTLRGSRTGVYAGVMAQEYGPRLHEGADG
YEGYLLTGSSSSVASGRISYVLGLEGPAVTVDTACSSSLVALHLAVRALRSGECDLALAG
GATVMAEPGMFVEFSRQRGLSAHGRCKAYSDSADGTGWAEGAGVLLVERLSDAVRHGRRV
LAVVRGSAVNQDGASNGLTAPNGRSQSRLIRQALADARLGVADVDVVEGHGTGTRLGDPI
EAQALLATYGQRDAGRPLRLGSLKSNVGHTQAAAGVAGVIKMVMAMRHGVLPKTLHVDEP
TAEVDWSAGAVSLLREQEAWPRGERVRRAGVSSFGVSGTNAHVVVEEAPVPEDGEAIEGG
APLAVVPVVVSGRSAGAVAELAGRVSEVAGSGRLVDVGLSSVVSRSVFEHRSVVLAGDSA
ELNAGLDALAADGVSPVLVSGVASGEGGRSVFVFPGQGTQWAGMALGLWAESAVFAESMA
RCEAAFAGLVEWRLADVLGDGSALERVDVVQPASFAVMVSLAELWRSLGVVPDAVVGHSQ
GEIAAAVVAGGLSLEDGARVVVLRARLIGRELAGRGGMASVALPVAVVEERLAGWAGRLG
VAVVNGPSATVVAGDVDAVGEFVTACEVEGVRARVLPVDYASHSAHVEDLKAELEQILAG
IGPVTGGIPFYSTSEAAQIDTAGLDAGYWFGNLRRPVRFQETVERLLADGFRVFVECGAH
PVLTGAVQETAESTGRQVCAVGSLRRDEGGLRRFLTSAAEAFVQGVGVSWPALFDGTGAR
TVDLPTYPFQRRRYWLESRPPAAVVPSGVQDGLSYEVVWKSLPVRESSRLDGRWLLVVPE
TLDADGTRIAHDLQHALTTHGATVSRVSVDVTTIDRADLSARLTTSAAEDQEPLGRVVSL
LGWAEGVRAHGPNVPTSVAASLALVQAVGDAGFGVPVWAVTRGAVSVVPGEVPETAGAQL
WALGRVAGLELPDRWGGLIDLPADADARTAGLAVRALAAGIADGEDQVAVRPSGAYGRRV
VQAAHREPSGAKTEWRPRGTVLVTGGMGAIGTRVARWLARNGAEHLVLTGRRGAGTPGAD
ELAGELRASGVQVTLAACDVSDRAALAALLDAHPPTAVFHTAGVLNDGTVDTLTPAHLDG
VLSPKATAAVHLHELTAHLDLDAFVLFASVTGVWGNGGQAGYAMANAALDALAEQRRAGG
LAATSISWGLWGGGGMAEGDGEVSLNRRGIRALEPATGIEALQRTLDQGATCRTVVDVDW
GQFAPRTAALRRGRLFADLPEVRRVLESEGVAREDAGTVEPGAVLAERLASRSEAEQRRM
LVELVRAEAAAVLRHDTTDLLAPRRSFKDAGFDSLTALELRNRLNTATGVVLPVTVVFDH
PNPGALADFLYGEALGLSAARSSASDTADTTRPAAAPEEPIAIVGMACRYPGEARSPEEL
WKLLIDERDVIGPMPTDRGWDVGGLFDPEPGVPGRSYVREGGFLHEAGEFDAGFFGISPR
EALAMDPQQRLLLETSWEALERAGIDPHTLRGSQTGVYAGMFHQEYATRLHEAPVEFEGH
LLTGTSGSVASGRISYVLGLEGPAVTVDTACSSSLVALHLAVRALRSGECDLALAGGVTV
MAEPGVFVEFSRQRGLAADGRCKAFAAAADGTGWAEGVGVLAVERLSDAVRHGRRVLAVV
RGSAVNQDGASNGLTAPNGPSQQRVIRQALADARLGVADVDVVEGHGTGTRLGDPIEAQA
LLATYGQRDAGRPLRLGSLKSNVGHTQAAAGVAGVIKMVMAMRHGVLPKTLHVDEVSPHV
DWSAGAVSLLTEQEPWPRGERVRRAGVSAFGVSGTNAHVVVEEAPASEAPVAVEPVEPGA
VGLLPVVPVVVSGRSAGAVAELASRLNESVRSDRLVDVGLSSVVSRSVFEHRSVVLAGDS
AELSAGLDALAADGVSPVLVSGVASVGGGRSVFVFPGAGVKWAGMALGLWAESAVFAESM
ARCEAAFAGLVEWRLADVLGDGAALEREDVVQPASFAVMVSLAALWRSLGVVPDAVVGHS
QGEIAAAVVAGGLSLEDGARVVVLRARVAEEVLSGGGIASVRLSRAEVEERLAGGGGGLS
VAVVNAPSSTVVAGELGELDRFVAACEAEGVRARRLEFGYASHSRFVEPVRERLLEGLAD
VRPVRGRIPFYSTVEAGEFDTAGLDAEYWFGNLRRPVRFQETVERLLADGFRVFVECGAH
PVLTGAVQETAETAGREVCAVGSLRRDEGGLRRFLTSAAEAFVQGVEVSWPVLFDGTGAR
TVDLPTYPFQRRHYWAQSSPAGAGSSAAARFGMTWEEHPLLGGALPLADSGELLLVGRIS
PASHSWIADHTVAGTALLPGTAFVDMALHAAAVAGCAGVEELSIEAPLPVHGGIRLQVVI
DEPDSSARRRVSVFARPEEEDGDAGRWTRHATGVLTPDVAPEPGRPQWCRQAWPPSGSVR
VEASELYDRFSALGYDYGEVFAGVEAVWLREGEAFAEVRLPTGAAPDAERFGVHPGLLDA
ALHPWLLGDFLSRPDGGSVLLPFAWRGITLHTAGADALRVRLGPAGEGALSLEAVDLSGA
PVLSMDALVLRPLAQDRLAELVGGTTSTPLYRVDWQRSPIARTAPSATGLFGSLPSGAVR
RWAVVGQGGVAARYATAEPGTGCVGVFPDLDALRTTLDSGADGPDIVLADFGARPGDAAP
HGTDPADGARDTVRRGLALIQGWLSDERFAAARLAVLTEHAVATEADTRRTDLAGSALWG
LMRSAQTEHPDRFVLVDHDGQDASYRTLPTALDSEIPQLALRAGETLAPELAVLPSPADG
GPATSAAFDPEGTVLVTGATGTLGSLLARHLVTAHGVRHLLLLSRSGREAAGAAELEREL
RQRGAEFQLLSCDATDRAALKEALATVPAAHPLTAVIHTAGVLDDGVVEALTPERLDRVL
RPKADAALNLHDLTEGMPLKAFVLYSGAVGLLGGAGQANYAAANAFLDGLAQHRHAQGLP
AVSLAWGLWSATSTFTDHLGEVDLRRMERSGITPLTDEQGLDLFDRALGAAVDAPQLCVM
GLDTAALRRQAAEHGPTSMPPLLRTLAAPPVRRGAGRSGRGGRAASATDAPSRAQALRER
LTGLDAAARRDELLVLSQAQLADVLGFADKTAVDPVRSFREIGLDSLTAVELRNRLGVVT
GLRLPPALVFDHPNLDALAAHLAELLAAEGRDDAGAAALSGIDALDRAVREMAADDTRRD
AVRRRLAELLAVVGDAPRDGGRAPRAAADAGGRDAQADPDLLGRLDSASDDDLFAFIEDQ
L
selected fasta
>polyketide synthase [polyketide synthase subunit]
ATGCGCGCACCCTACGGAAATCGGCAGGTCAACCGGCGATTCCTGCGGGAATTCCGAGCG
AAACGGCCTCACTGTGTTTCCCCGCTGCATTTCCTCGCTGAATTCAGCGAATCCCGGCAG
ACGACCGGCTCTGCCGGCGTGACAGCCCCTATCGATCGACCAGGAGTTTCGATGGCCCCG
AAGAGTGGTGCGCAGCGTTCGAGCGACATAGCCGTCGTCGGCATGTCCTGCCGCCTTCCG
GGGGCACCGGGCATCGATGAGTTCTGGCATCTGCTGACCACCGGAGGCAGCGCGATCGAG
CGTCGCGCCGACGGCACCTGGCGCGGCTCCCTGGACGGAGCCGCCGACTTCGACGCCGCC
TTCTTCGACATGACCCCCCGCCAGGCCGCCGCCGCCGACCCGCAGCAACGACTCATGCTG
GAACTCGGCTGGACGGCCCTGGAGAACGCCGGGATCGTCCCCGGCAGCCTCGCCGGCACG
GACACCGGCGTCTTCGTCGGCATCGCGGCCGACGACTACGCGGCACTCCTGCACCGGTCC
GCCACCCCCGTCAGCGGGCACACCGCGACGGGCCTGAGCCGGGGCATGGCCGCCAACCGC
CTCTCCTACCTCCTGGGCCTGCGCGGTCCCAGCCTCGCGGTGGACAGCGCGCAGTCCTCC
TCGCTCGTCGCGGTCCACCTGGCCTGCGAGAGCCTGCGCCGCGGCGAGTCCGACCTCGCG
ATCGTCGGCGGCGTCAGCCTGATCCTCGCCGAGGACAGCACGGCGGGCATGGAGCTCATG
GGCGCGCTCTCGCCGGACGGCCGCTGCCACACCTTCGACGCACGCGCCAACGGCTACGTA
CGCGGTGAGGGCGGAGCCTGCGTCGTCCTCAAGCCCCTGGAGCGGGCACTGGCCGACGGG
GACCGCGTCCACTGCGTCGTCCGAGGAAGCGCGGTCAACAACGACGGCGGCGGCTCCACC
CTGACCACCCCCCACCGCGAGGCCCAGGCCGCCGTCCTGCGGGCGGCGTACGAACGGGCC
GGGGTCGGCCCGGACCAGGTGTCCTACGTCGAACTGCACGGTACGGGGACGCCGGTCGGC
GACCCCGTCGAGGCGGCGGCTCTCGGCGCGGTCCTCGGCACGGCCCACGGCCGTAACGCC
CCGCTGTCCGTGGGATCGGTCAAGACGAACGTCGGCCACCTGGAGGCGGCCGCGGGCCTC
GTGGGATTCGTGAAGGCAGCCCTGTGCGTCCGCGAGGGCGTGGTGCCGCCGAGCCTGAAC
CACGCGACGCCCAACCCTGCCATCCCCATGGACCGGCTAAACCTGCGCGTACCCACGCGA
CTGGAGCCCTGGCCGCACCCGGACGACCGAGCGACCGGCCGGCTGCGACTGGCCGGCGTC
TCGTCCTTCGGCATGGGTGGGACGAACGCGCATGTGGTGGTGGAGGAGGCGCCGCTTCCG
GAGGCCGGGGAGCCGGTCGGGGCCGGTGTGCCTTTGGCTGTGGTGCCGGTGGTGGTGTCG
GGTCGTTCTGCGGGTGCGGTGGCTGAACTGGCCTCCCGCTTGAACGAGTCGGTTCGTTCG
GATCGGTTGGTGGATGTGGGGTTGTCGTCGGTGGTGTCGCGGTCGGTGTTCGAGCATCGG
TCCGTGGTTCTGGCGGGGGACTCTGCCGAGCTGAGTGCCGGTTTGGATGCTCTGGCCGCT
GACGGAGTGTCTCCTGTCCTGGTGTCGGGTGTGGCGTCGGTCGGGGGTGGCCGGTCGGTG
TTCGTGTTCCCGGGTGCGGGGGTGAAGTGGGCGGGGATGGCGCTCGGGTTGTGGGCGGAG
TCTGCTGTGTTTGCGGAGTCGATGGCGCGGTGTGAGGCGGCGTTCGCCGGGTTGGTGGAG
TGGCGTCTGGCGGATGTGCTGGGTGATGGGGCTGCGTTGGAGCGTGAGGACGTGGTGCAG
CCGGCGTCGTTCGCGGTGATGGTGTCGTTGGCGGCGTTGTGGCGGTCGTTGGGTGTGGTG
CCGGATGCGGTGGTGGGGCATTCGCAGGGGGAGATCGCTGCTGCGGTGGTGGCGGGTGGT
CTGTCGTTGGAGGACGGGGCGCGTGTGGTGGTGTTGCGTGCGCGGGTGGCTGAGGAGGTT
TTGTCGGGTGGGGGGATTGCTTCGGTGCGTCTTTCGCGGGCCGAGGTGGAGGAGCGGTTG
GCGGGTGGGGGTGGTGGGTTGAGTGTGGCGGTGGTGAATGCGCCGTCGTCGACGGTGGTG
GCGGGTGAGTTGGGGGATTTGGATCGGTTTGTTGCGGCGTGTGAGGCGGAGGGGGTGCGG
GCGCGTCGGCTGGAGTTCGGGTATGCGTCGCATTCGAGGTTCGTGGAGCCGGTGCGTGAG
CGGTTGTTGGAGGGGTTGGCCGATGTCCGTCCGGTGAGGGGGCGGATTCCGTTCTATTCG
ACGGTGGAGGCTGCGGAGTTCGATACGGCTGGTCTGGATGCGGAGTACTGGTTCGGGAAT
CTGCGTCGGCCGGTTCGCTTCCAGGAGACGGTCGAGCGGCTGTTGGCGGATGGTTTCCGG
GTGTTCGTGGAGTGCGGCGCGCATCCGGTGCTGACCGGGGCGGTGCAGGAGACCGCGGAG
ACTGCGGGCCGGGAGATCTGCTCCGTCGGATCCCTGCGTCGTGACGAGGGTGGACTGCGT
CGCTTCCTGACCTCTGCGGCGGAGGCGTTCGTCCAGGGGGTGGAGGTGTCCTGGCCGGTG
CTGTTCGACGGCACCGGCGCCCGGACGGTCGACCTGCCCACCTACCCCTTCCAACGCCGG
CACCACTGGGCACCCGACGGCTCCGCGTCGGCGGCGCCCACACGGGACATCCGACCGGAC
GAGACCGCCGCGGTTCCAGCGGACACGATGGACCTCGCGGGACAACTTCGCGCGGACGTG
GCGTCGTTGCCCACCACCGAGCAGATCGCGCGGTTGCTCGACCAGGTACGCGACGGTGTC
GCCACGGTCCTCGGACTGGACGCCCGGGACGAGGTGCGCGCGGAGGCGACGTTCAAGGAA
CTGGGCGTCGAATCGCTGACCGGCGTCGAGCTGAAGAACCACCTCCGTGCCCGGACCGGA
CTGCACGTCCCCACCTCGCTGATCTACGACTGCCCGACTCCCCTCGCCGCCGCTCACTAC
CTCCGCGACGAGCTCTTGGGCCGACCCGCGGAGCAGGCCGTCGTCCCCGCCGGCATCCCG
GTCGACGAACCGATCGCGATCGTGGGGATGGGGTGCCGTCTGCCGGGTGGGGTGTCGTCG
CCGGAGGGGTTGTGGGATCTGGTGGCGTCGGGGGTGGATGCGGTTTCTCCGTTCCCCACG
GATCGGGGTTGGGATGTGGGGGGTCTGTTCGATCCGGAGCCGGGGGTGCCGGGGCGTTCG
TATGTGCGTGAGGGCGGGTTCCTTCATGAGGCGGGGGAGTTCGACGCGGGGTTCTTCGGT
ATCTCTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGTTGCTGGAGACGTCG
TGGGAGGCGTTGGAGCGGGCGGGCATCGATCCGCACACGCTTCGCGGTTCACGGACCGGC
GTCTACGCCGGAGTGATGGCCCAGGAATACGGCCCCCGACTCCACGAAGGCGCAGACGGA
TACGAGGGCTATCTGCTGACCGGATCCTCCAGCAGTGTCGCCTCGGGTCGTATCTCGTAC
GTGCTGGGTCTGGAAGGGCCGGCGGTGACGGTGGACACCGCGTGCTCGTCGTCGCTGGTC
GCGCTGCACCTGGCCGTGCGGGCGCTGCGCAGCGGTGAGTGCGACCTCGCCCTCGCCGGC
GGCGCGACCGTCATGGCCGAACCCGGCATGTTCGTGGAGTTCTCACGGCAGCGCGGGCTG
TCTGCCCACGGACGGTGCAAGGCGTACTCGGACTCGGCCGATGGCACGGGCTGGGCCGAG
GGGGCGGGTGTGCTGCTCGTCGAGCGGTTGTCGGATGCGGTACGTCATGGGCGTCGGGTG
CTGGCGGTCGTGCGTGGTTCCGCGGTCAACCAGGACGGTGCGAGCAACGGACTGACGGCG
CCGAACGGGCGGTCCCAGTCGCGTTTGATCCGTCAGGCGTTGGCGGATGCGCGGTTGGGT
GTGGCTGATGTGGATGTGGTGGAGGGCCACGGCACGGGGACGCGTCTGGGTGATCCGATC
GAGGCGCAGGCGTTGTTGGCGACGTATGGGCAGCGGGATGCGGGTCGGCCTCTGCGGCTT
GGTTCGCTGAAGTCGAACGTGGGGCATACGCAGGCGGCTGCCGGTGTGGCGGGCGTGATC
AAGATGGTCATGGCGATGCGGCACGGTGTCCTGCCGAAGACGCTGCACGTGGATGAGCCG
ACGGCGGAGGTGGACTGGTCGGCCGGCGCGGTGTCCCTGCTGAGGGAGCAGGAGGCGTGG
CCGCGTGGCGAGCGTGTGCGGCGGGCCGGAGTCTCCTCGTTCGGCGTGAGTGGGACGAAC
GCGCATGTGGTGGTCGAGGAGGCGCCGGTTCCGGAGGACGGGGAGGCGATCGAGGGCGGT
GCGCCTTTGGCTGTGGTGCCGGTGGTGGTGTCGGGTCGTTCTGCGGGTGCGGTGGCGGAG
CTGGCGGGCCGGGTCAGCGAGGTCGCTGGGTCTGGTCGGTTGGTGGATGTGGGGTTGTCG
TCGGTGGTGTCGCGGTCGGTGTTCGAGCACCGGTCCGTGGTGCTGGCGGGGGACTCTGCC
GAGCTGAATGCCGGTCTGGATGCTCTGGCCGCTGACGGAGTGTCTCCTGTCCTGGTGTCG
GGTGTGGCGTCGGGTGAGGGTGGCCGGTCGGTGTTCGTGTTCCCTGGTCAGGGGACGCAG
TGGGCGGGGATGGCGCTCGGGTTGTGGGCGGAGTCGGCGGTGTTCGCGGAGTCGATGGCG
CGGTGTGAGGCGGCGTTCGCCGGGTTGGTGGAGTGGCGTCTGGCGGATGTGCTGGGTGAC
GGGTCTGCGTTGGAGCGGGTCGATGTGGTGCAGCCGGCGTCGTTCGCGGTGATGGTGTCG
CTGGCGGAGTTGTGGCGGTCGTTGGGTGTGGTGCCGGATGCGGTGGTGGGGCATTCGCAG
GGGGAGATCGCTGCTGCGGTGGTGGCGGGTGGTCTCTCGCTGGAGGATGGCGCGCGTGTG
GTGGTGTTGCGTGCGCGGTTGATAGGCCGTGAGCTGGCCGGGCGCGGTGGGATGGCGTCG
GTGGCGCTGCCGGTCGCGGTGGTGGAGGAGCGTCTGGCGGGGTGGGCGGGGCGTCTGGGT
GTGGCGGTGGTCAACGGACCCTCCGCCACGGTCGTCGCGGGTGATGTGGATGCGGTGGGG
GAGTTTGTGACCGCGTGCGAGGTGGAGGGGGTTCGGGCGCGTGTTCTGCCGGTGGACTAC
GCCTCGCACTCGGCGCACGTGGAGGACCTGAAAGCCGAGCTTGAACAGATTCTGGCCGGC
ATCGGCCCGGTGACCGGTGGCATCCCGTTCTATTCGACGTCCGAAGCCGCGCAGATCGAC
ACGGCTGGTCTGGACGCGGGGTACTGGTTCGGGAATCTGCGTCGGCCGGTGCGGTTCCAG
GAGACGGTCGAGCGGTTGCTGGCGGATGGTTTCCGGGTGTTCGTGGAGTGTGGCGCGCAT
CCGGTGCTGACGGGGGCGGTGCAGGAGACCGCGGAATCCACCGGTCGCCAGGTGTGTGCG
GTCGGATCCCTGCGTCGTGACGAGGGAGGTCTGCGCCGCTTCCTGACCTCTGCGGCGGAG
GCGTTCGTCCAGGGGGTCGGGGTGTCCTGGCCGGCACTGTTCGACGGCACCGGCGCCCGC
ACGGTCGACCTGCCCACCTATCCCTTCCAGCGTCGGCGTTACTGGCTGGAGTCACGTCCT
CCTGCGGCGGTTGTTCCGTCGGGGGTCCAGGACGGATTGTCGTATGAGGTGGTGTGGAAG
AGCCTGCCGGTACGGGAGTCGTCGCGTCTTGACGGCCGGTGGCTGCTCGTCGTGCCCGAA
ACCCTGGACGCCGACGGCACGCGGATCGCCCACGACCTCCAGCACGCCCTCACCACCCAC
GGCGCCACGGTCTCCCGTGTGTCGGTCGACGTGACGACGATCGACCGCGCCGACCTGTCG
GCGCGGCTCACCACGAGCGCGGCCGAAGACCAGGAACCGCTTGGGCGAGTGGTGTCCCTC
CTGGGGTGGGCCGAGGGAGTACGGGCCCATGGCCCGAACGTACCGACTTCCGTCGCCGCC
TCCCTGGCACTCGTGCAGGCTGTCGGCGATGCCGGGTTCGGTGTTCCGGTGTGGGCGGTG
ACGCGGGGTGCGGTGTCCGTGGTGCCTGGTGAGGTGCCGGAGACGGCGGGTGCGCAACTG
TGGGCGCTCGGCCGGGTCGCCGGTCTCGAACTTCCCGACCGTTGGGGTGGTCTGATCGAT
CTTCCGGCGGATGCCGATGCGCGTACGGCGGGGCTTGCGGTGCGGGCCCTGGCCGCCGGG
ATCGCCGATGGTGAGGACCAGGTGGCGGTGCGCCCCTCGGGTGCCTACGGCCGGCGTGTA
GTTCAGGCAGCCCACCGGGAGCCGTCGGGAGCGAAGACGGAGTGGCGACCGCGTGGCACC
GTGCTCGTCACCGGGGGAATGGGCGCCATCGGCACTCGGGTGGCCCGCTGGCTGGCCCGG
AACGGAGCCGAACACCTGGTGCTGACCGGCCGCCGCGGTGCCGGGACCCCCGGCGCGGAC
GAGCTGGCGGGAGAGCTGAGGGCGTCCGGAGTCCAGGTCACGCTCGCCGCCTGCGACGTG
TCCGATCGTGCCGCGCTGGCCGCGCTGCTCGACGCGCATCCGCCGACCGCCGTCTTCCAC
ACGGCCGGTGTACTGAACGACGGAACGGTCGACACGCTCACTCCCGCTCACCTGGACGGG
GTCCTGAGCCCCAAGGCGACGGCCGCCGTTCACCTGCACGAGCTCACCGCCCACCTGGAC
CTGGACGCCTTCGTCCTCTTCGCCTCCGTCACCGGCGTATGGGGTAACGGCGGCCAGGCC
GGGTACGCCATGGCCAACGCGGCTCTGGACGCGCTCGCCGAGCAGCGCCGTGCCGGCGGA
CTTGCGGCGACCTCCATCAGTTGGGGCCTCTGGGGTGGCGGCGGCATGGCCGAGGGTGAC
GGCGAGGTGAGCCTCAACCGTCGTGGAATCCGCGCTCTTGAGCCCGCCACCGGCATCGAG
GCGCTGCAGCGGACGCTCGACCAGGGCGCCACCTGCCGCACCGTCGTCGACGTGGACTGG
GGTCAGTTCGCTCCTCGTACGGCGGCGCTGCGGCGCGGGCGGCTCTTCGCGGATCTGCCC
GAGGTGCGGCGTGTCCTGGAGTCCGAGGGGGTTGCACGGGAGGACGCCGGAACCGTCGAG
CCCGGCGCCGTGCTCGCCGAGCGCCTCGCATCGCGCTCCGAGGCCGAACAGCGACGCATG
CTCGTCGAGTTGGTACGAGCCGAAGCGGCTGCCGTCCTGCGTCACGACACGACGGACCTC
CTGGCGCCGCGCAGGTCGTTCAAGGACGCCGGGTTCGACTCCTTGACCGCGCTGGAGCTC
CGTAACCGGCTGAACACCGCCACCGGTGTCGTCCTTCCCGTCACCGTCGTCTTCGACCAC
CCGAACCCCGGTGCACTGGCGGACTTCCTGTACGGCGAAGCACTGGGCCTGTCCGCGGCC
AGGTCTTCCGCGAGCGATACGGCCGACACGACCCGCCCGGCCGCCGCCCCCGAAGAGCCG
ATCGCGATCGTCGGAATGGCCTGCCGCTACCCGGGCGAGGCCCGTTCCCCCGAGGAACTG
TGGAAGTTGCTCATCGACGAACGGGACGTCATCGGCCCCATGCCCACGGATCGGGGTTGG
GATGTGGGGGGTCTGTTCGATCCGGAGCCGGGGGTGCCGGGGCGTTCGTATGTGCGTGAG
GGCGGGTTCCTTCATGAGGCGGGGGAGTTCGACGCGGGGTTCTTCGGTATTTCTCCGCGT
GAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGTTGCTGGAGACGTCGTGGGAGGCGTTG
GAGCGGGCGGGCATCGATCCGCACACGCTCCGCGGCTCACAGACCGGCGTCTACGCGGGG
ATGTTCCACCAGGAGTACGCGACCCGGCTGCACGAGGCACCCGTGGAGTTCGAAGGCCAC
TTGCTGACGGGGACGTCCGGGAGTGTGGCTTCGGGTCGTATCTCGTATGTGCTGGGTCTG
GAGGGGCCGGCGGTGACGGTGGACACGGCGTGTTCGTCGTCGTTGGTGGCGCTGCATCTG
GCGGTGCGGGCGTTGCGGAGTGGTGAGTGTGACCTTGCTCTTGCGGGTGGGGTGACGGTG
ATGGCGGAGCCGGGTGTGTTCGTGGAGTTCTCGCGGCAGCGGGGGTTGGCTGCGGACGGG
CGGTGCAAGGCGTTCGCGGCTGCTGCCGATGGCACGGGCTGGGCCGAGGGTGTGGGCGTG
CTGGCGGTGGAGCGGTTGTCGGATGCGGTGCGTCATGGGCGTCGGGTGCTGGCGGTGGTG
CGTGGCTCGGCGGTGAATCAGGACGGTGCGAGCAATGGGTTGACGGCTCCGAACGGTCCG
TCGCAGCAGCGGGTGATTCGTCAGGCGTTGGCGGATGCGCGGTTGGGTGTGGCTGATGTG
GATGTGGTGGAGGGGCATGGGACGGGGACGCGTCTGGGTGATCCGATCGAGGCGCAGGCG
TTGTTGGCGACGTATGGGCAGCGGGATGCGGGTCGGCCTCTGCGGCTTGGTTCGCTGAAG
TCGAATGTGGGGCATACGCAGGCGGCTGCCGGTGTGGCGGGCGTGATCAAGATGGTCATG
GCGATGCGGCACGGGGTCCTGCCGAAGACGCTGCACGTCGATGAGGTCTCTCCGCACGTC
GACTGGTCGGCGGGCGCGGTGTCCCTGCTGACGGAGCAGGAGCCGTGGCCCCGTGGTGAG
CGCGTACGGCGGGCTGGTGTCTCCGCGTTCGGTGTGAGTGGGACGAACGCGCATGTGGTG
GTGGAGGAGGCACCTGCTTCGGAGGCGCCGGTCGCGGTGGAGCCGGTGGAGCCGGGGGCT
GTGGGGCTTCTTCCGGTGGTGCCCGTGGTGGTGTCGGGTCGTTCTGCGGGTGCGGTGGCT
GAACTGGCCTCCCGCTTGAACGAGTCGGTTCGTTCGGATCGGTTGGTGGATGTGGGGTTG
TCGTCGGTGGTGTCGCGGTCGGTGTTCGAGCATCGGTCCGTGGTTCTGGCGGGGGACTCT
GCCGAGCTGAGTGCCGGTTTGGATGCTCTGGCCGCTGACGGAGTGTCTCCTGTCCTGGTG
TCGGGTGTGGCGTCGGTCGGGGGTGGCCGGTCGGTGTTCGTGTTCCCGGGTGCGGGGGTG
AAGTGGGCGGGGATGGCGCTCGGGTTGTGGGCGGAGTCTGCTGTGTTTGCGGAGTCGATG
GCGCGGTGTGAGGCGGCGTTCGCCGGGTTGGTGGAGTGGCGTCTGGCGGATGTGCTGGGT
GATGGGGCTGCGTTGGAGCGTGAGGACGTGGTGCAGCCGGCGTCGTTCGCGGTGATGGTG
TCGTTGGCGGCGTTGTGGCGGTCGTTGGGTGTGGTGCCGGATGCGGTGGTGGGGCATTCG
CAGGGGGAGATCGCTGCTGCGGTGGTGGCGGGTGGTCTGTCGTTGGAGGACGGGGCGCGT
GTGGTGGTGTTGCGGGCGCGGGTGGCTGAGGAGGTTTTGTCGGGTGGGGGGATTGCTTCG
GTGCGTCTTTCGCGGGCCGAGGTGGAGGAGCGGTTGGCGGGTGGGGGTGGTGGGTTGAGT
GTGGCGGTGGTGAATGCGCCGTCGTCGACGGTGGTGGCGGGTGAGTTGGGGGAGTTGGAT
CGGTTTGTTGCGGCGTGTGAGGCGGAGGGGGTGCGGGCGCGTCGGCTGGAGTTCGGGTAT
GCGTCGCATTCGAGGTTCGTGGAGCCGGTGCGTGAGCGGTTGTTGGAGGGGTTGGCCGAT
GTCCGTCCGGTGAGGGGGCGGATTCCGTTCTATTCGACGGTGGAGGCTGGGGAGTTCGAT
ACGGCTGGTCTGGATGCGGAGTACTGGTTCGGGAATCTGCGTCGGCCGGTTCGGTTCCAG
GAGACGGTCGAGCGGTTGTTGGCGGATGGTTTCCGGGTGTTCGTGGAGTGTGGTGCGCAT
CCGGTGCTGACCGGGGCGGTGCAGGAGACCGCGGAGACTGCGGGCCGGGAGGTGTGTGCG
GTTGGTTCGCTGCGTCGTGACGAGGGAGGTCTCCGTCGCTTCCTGACCTCTGCGGCGGAG
GCGTTCGTCCAGGGGGTGGAGGTGTCCTGGCCGGTGCTGTTCGACGGCACCGGCGCCCGC
ACGGTCGACCTGCCCACCTACCCCTTCCAACGCCGCCACTACTGGGCACAGTCCTCGCCC
GCCGGCGCCGGCAGCTCTGCTGCGGCCCGCTTCGGTATGACCTGGGAGGAGCATCCGCTC
CTCGGCGGCGCGCTGCCGCTCGCGGACTCCGGCGAGCTGCTGCTCGTCGGGAGGATCTCC
CCGGCCTCCCACTCCTGGATCGCCGACCACACCGTGGCCGGGACCGCCCTGCTGCCCGGG
ACGGCCTTCGTCGACATGGCACTGCACGCCGCCGCGGTCGCGGGCTGTGCGGGTGTGGAG
GAGCTGAGCATCGAGGCCCCGCTGCCGGTGCACGGCGGGATCCGGCTCCAGGTGGTGATC
GACGAGCCCGACTCCTCCGCGCGGCGCCGCGTGAGCGTGTTCGCGAGGCCGGAAGAGGAA
GACGGGGACGCCGGCCGCTGGACCCGACACGCCACCGGCGTGCTGACCCCCGACGTCGCC
CCCGAGCCGGGCCGGCCGCAGTGGTGCCGGCAGGCCTGGCCGCCGAGCGGCTCCGTCCGG
GTGGAGGCGTCGGAGCTCTACGACCGGTTCTCCGCGCTGGGATACGACTACGGCGAGGTC
TTCGCCGGGGTCGAGGCCGTCTGGCTGCGCGAGGGCGAGGCCTTCGCCGAGGTCCGCCTG
CCCACGGGCGCGGCGCCCGACGCCGAGCGGTTCGGGGTGCACCCCGGCCTCCTCGACGCG
GCTCTGCACCCCTGGCTGCTGGGCGACTTCCTGTCGCGGCCCGACGGCGGATCCGTACTG
CTGCCGTTCGCGTGGCGCGGCATCACGCTCCACACGGCCGGTGCCGACGCGCTGCGGGTC
CGTCTCGGACCGGCCGGAGAAGGCGCTCTGTCGCTCGAAGCCGTCGACCTCTCCGGTGCC
CCGGTGCTGTCGATGGACGCACTGGTGCTGCGTCCGCTCGCCCAGGACCGCCTGGCGGAA
CTGGTCGGCGGCACGACCTCCACCCCGCTGTACCGCGTGGACTGGCAGCGGAGCCCGATC
GCGAGGACGGCGCCGTCGGCCACGGGGCTCTTCGGCTCCCTCCCGTCCGGTGCCGTCCGC
CGCTGGGCGGTCGTCGGGCAGGGCGGTGTCGCCGCACGGTACGCGACGGCGGAACCCGGC
ACGGGGTGCGTCGGGGTCTTCCCCGACCTGGACGCACTGCGTACGACGCTGGACTCCGGA
GCGGACGGCCCCGACATCGTCCTCGCCGACTTCGGGGCCCGGCCAGGCGACGCCGCGCCG
CACGGGACGGATCCGGCCGACGGCGCACGCGACACGGTCCGGCGGGGGCTCGCCCTCATA
CAGGGCTGGCTGTCCGACGAGCGCTTCGCCGCCGCGCGTCTCGCCGTGCTCACCGAGCAC
GCCGTCGCCACCGAGGCGGACACCCGCCGGACGGACCTCGCGGGCTCGGCACTGTGGGGG
CTGATGCGTTCGGCGCAGACCGAGCACCCCGACCGCTTCGTCCTCGTCGACCACGACGGG
CAGGACGCCTCGTACCGGACGCTGCCCACCGCGCTCGACAGCGAAATCCCGCAACTGGCG
CTCCGAGCCGGGGAGACGCTGGCCCCCGAACTGGCGGTCCTGCCGAGTCCGGCCGACGGG
GGGCCCGCGACAAGCGCGGCGTTCGATCCCGAAGGCACGGTACTCGTCACCGGAGCCACC
GGCACCCTCGGCAGCCTGCTGGCCCGGCACCTGGTCACGGCACACGGCGTACGGCATCTG
CTGCTGCTCAGCCGCAGCGGACGCGAAGCCGCGGGGGCCGCCGAACTGGAGCGTGAACTC
CGTCAACGGGGAGCCGAGTTCCAGCTCCTCTCCTGTGACGCGACGGACCGGGCAGCGCTG
AAGGAGGCCCTCGCCACCGTCCCCGCCGCCCACCCGCTGACCGCGGTGATCCACACGGCC
GGCGTCCTCGACGACGGCGTCGTCGAGGCGCTGACCCCCGAACGGCTGGACCGCGTGCTG
CGCCCCAAGGCGGACGCCGCGCTGAACCTGCACGACCTGACCGAGGGAATGCCGCTGAAG
GCGTTCGTCCTGTACTCCGGGGCGGTCGGACTGCTGGGTGGAGCGGGCCAGGCCAACTAC
GCGGCAGCCAACGCGTTCCTGGACGGCCTGGCCCAACACCGGCACGCGCAAGGGCTGCCC
GCGGTGTCCCTGGCATGGGGACTCTGGAGCGCCACCAGCACGTTCACCGACCATCTCGGC
GAGGTGGACCTGCGGCGCATGGAGCGGTCCGGCATCACGCCGCTCACGGACGAGCAGGGC
CTTGACCTGTTCGACCGGGCCCTCGGCGCCGCGGTGGACGCGCCGCAGCTCTGCGTGATG
GGGCTGGACACGGCGGCGCTGCGCCGGCAGGCGGCCGAGCACGGGCCGACTTCGATGCCT
CCTCTGCTGCGTACGCTGGCGGCGCCTCCCGTACGGCGCGGCGCGGGGCGCTCCGGCCGG
GGCGGACGGGCGGCGTCCGCCACGGACGCGCCGAGCCGGGCGCAGGCCCTGCGCGAGCGA
CTGACGGGCCTGGACGCGGCGGCACGGCGGGACGAACTCCTGGTCCTGTCGCAGGCGCAG
TTGGCCGATGTGCTGGGCTTCGCCGACAAGACCGCGGTGGACCCCGTTCGTTCCTTCCGC
GAGATCGGTCTGGACTCGCTGACCGCCGTCGAGCTGCGCAACCGGCTCGGTGTCGTCACC
GGACTGCGGCTGCCGCCGGCGCTGGTCTTCGACCACCCCAACCTCGACGCGCTCGCGGCC
CACCTGGCGGAGCTCCTCGCGGCTGAGGGCCGGGACGACGCGGGCGCCGCGGCGCTCTCG
GGAATCGACGCCCTGGACCGGGCGGTCCGGGAGATGGCGGCCGACGACACGCGCCGTGAC
GCCGTCCGCCGACGCCTCGCGGAACTGCTGGCGGTGGTCGGCGACGCCCCGCGGGACGGC
GGCCGCGCCCCACGGGCGGCCGCCGACGCGGGAGGCCGCGACGCTCAAGCGGACCCCGAC
CTGCTGGGCCGGCTGGACTCCGCCTCCGACGACGATCTGTTCGCGTTCATCGAAGACCAG
CTGTGA
[0] KSQ68..420
[0] AT580..896
[0] malonyl-CoA not conserved HAFHS, conserved signature for methylmalonyl-CoA768..772
[0] ACP972..1042
[1] KS1062..1438
[1] AT1591..1907
[1] methylmalonyl-CoA1780..1784
[1] KR2179..2354
[1] ACP2457..2531
[2] KS2559..2934
[2] AT3092..3408
[2] malonyl-CoA not conserved HAFHS, conserved signature for methylmalonyl-CoA3280..3284
[2] DH3458..3624
[2] KR3972..4152
[2] ACP4273..4343
[0] KSQ202..1260
[0] AT1738..2688
[0] malonyl-CoA not conserved HAFHS, conserved signature for methylmalonyl-CoA2302..2316
[0] ACP2914..3126
[1] KS3184..4314
[1] AT4771..5721
[1] methylmalonyl-CoA5338..5352
[1] KR6535..7062
[1] ACP7369..7593
[2] KS7675..8802
[2] AT9274..10224
[2] malonyl-CoA not conserved HAFHS, conserved signature for methylmalonyl-CoA9838..9852
[2] DH10372..10872
[2] KR11914..12456
[2] ACP12817..13029

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [576-700]  G3DSA:3.40.366.10 [768-885]  G3DSA:3.40.366.10 [1584-1711]  G3DSA:3.40.366.10 [1780-1897]  G3DSA:3.40.366.10 [3088-3212]  G3DSA:3.40.366.10 [3280-3397]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2489-2504]  PS00012 [4301-4316]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [965-1079]  1.10000150671642e-25 SSF47336 [2454-2575]  4.00000300869883e-24 SSF47336 [4264-4350]  1.70000295590054e-19 SSF47336
SSF47336   ACP_like
 [974-1041]  7.59999999999999e-10 PF00550 [2464-2530]  7.90000000000001e-12 PF00550 [4281-4342]  4.3e-11 PF00550
PF00550   PP-binding
 [972-1042]  PS50075 [2457-2531]  PS50075 [4273-4343]  PS50075
PS50075   ACP_DOMAIN
 [972-1045]  2.50000000000001e-56 G3DSA:1.10.1200.10 [2459-2533]  2.50000000000001e-56 G3DSA:1.10.1200.10 [4277-4347]  2.50000000000001e-56 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2179-2353]  3.7e-58 PF08659 [3972-4151]  3.5e-59 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [68-296]  7.90000000000016e-74 PF00109 [1062-1313]  4.49999999999996e-99 PF00109 [2559-2809]  2.99999999999998e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [305-420]  1.80000000000002e-39 PF02801 [1321-1438]  1.80000000000002e-46 PF02801 [2817-2934]  1.99999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [580-896]  1.20000000000001e-95 PF00698 [1591-1907]  8.70000000000003e-101 PF00698 [3092-3408]  5.09999999999992e-96 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [578-877]  5.09998762524166e-62 SSF52151 [1589-1889]  2.30000440726534e-63 SSF52151 [3090-3389]  9.30000048475975e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [702-767]  3.0999994589937e-15 SSF55048 [1714-1779]  7.79998304125571e-18 SSF55048 [3214-3279]  3.50000235434314e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [68-307]  G3DSA:3.40.47.10 [308-478]  G3DSA:3.40.47.10 [1065-1325]  G3DSA:3.40.47.10 [1326-1489]  G3DSA:3.40.47.10 [2561-2821]  G3DSA:3.40.47.10 [2822-2986]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [60-476]  2.1000026783403e-83 SSF53901 [1055-1436]  7.49999605851445e-102 SSF53901 [2551-2932]  6.4999795054176e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2179-2360]  4.89999999999996e-72 G3DSA:3.40.50.720 [3973-4154]  4.89999999999996e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1226-1242]  PS00606 [2722-2738]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [582-876]  2.80000504261099e-105 SM00827 [1593-1888]  4.99996518094122e-112 SM00827 [3094-3388]  7.19996395544006e-106 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [973-1045]  4.30000170645867e-24 SM00823 [2462-2534]  9.39998942703831e-32 SM00823 [4274-4346]  4.09999599045784e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3458-3624]  1.50000965748778e-69 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [70-479]  SM00825 [1065-1490]  SM00825 [2561-2986]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2179-2354]  3.39999972437719e-52 SM00822 [3972-4152]  5.8999880940569e-58 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit