close all open/close all

CDS information : Chalc_00260


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction63,522 / 64,760 / + [in whole cluster]
63,522 / 64,760 / + [in contig]
Location63522..64760 [in whole cluster]
63522..64760 [in contig]
TypeCDS
Length1,239 bp (412 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein
Product (GenBank)putative NDP-hexose 3,4-isomerase
Gene
Gene (GenBank)chmCII
EC number
Keyword
  • D-chalcose
Note
Note (GenBank)
  • similar to EryCII, TylMIII; putative D-chalcose pathway component
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q54823
NITE
Adria_00350
PmId
[7592454] Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis. (J Bacteriol. , 1995)
[17049185] Functional analysis of desVIII homologues involved in glycosylation of macrolide antibiotics by interspecies complementation. (Gene. , 2007)
ACC
Q9ZGH8
NITE
Pikro_00080
PmId
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein [putative NDP-hexose 3,4-isomerase]
MTTQWTTPSVLGRRLQRTYVGHWFAGTQGDPYALILRAQRDDTTPYEEDVRARGPVFHSE
VLDTWVITDGALARSVLTDARFGGLTRAGGRYRAELLPPAGPEVGPARAGVRGGVRADAD
PAVSAQDEVVVEALAEQLSRTLLGGLGDDFDLVAAFARRLPAQVLAEFLGLPAAARSRFE
ELLAGCAHSLDSRLCPQTLDITRTGLGAAAELRELLARHLGGSGPRSAQAAVSLAVEVAA
PAGALICNAVEALSSSPGQWNALRQNPEKADAVVAETWWRRPPVRVESRIAQEDVDVAGV
PVPADGHVAILVAAAQRDPAITPAPTKDDTGTPGQGDCGVPLGLVGDAHATSAARTVRAL
CRGALRALAQEAPGLRPNGTPVRLRRAPVTLGHARFPVARTGRGTPTDAGAA
selected fasta
>putative glycosyltransferase helper protein [putative NDP-hexose 3,4-isomerase]
GTGACAACGCAGTGGACCACCCCGTCCGTGCTCGGCCGCAGACTGCAACGCACCTACGTG
GGGCACTGGTTCGCAGGAACGCAGGGAGACCCCTACGCGCTGATCCTGCGCGCCCAGCGG
GACGACACCACCCCCTACGAGGAGGACGTCCGCGCACGCGGACCGGTGTTCCACAGCGAG
GTGCTCGACACCTGGGTGATCACGGACGGCGCTCTCGCCCGGTCCGTCCTGACCGACGCC
CGCTTCGGCGGGCTGACGCGCGCGGGAGGACGGTATCGCGCGGAGCTTCTCCCTCCGGCG
GGCCCCGAGGTCGGTCCGGCCCGCGCAGGGGTACGCGGCGGCGTGCGGGCCGACGCCGAT
CCGGCGGTGTCGGCGCAGGACGAGGTGGTGGTGGAGGCCCTCGCCGAGCAGCTCTCACGC
ACCCTCCTGGGCGGACTCGGCGACGACTTCGACCTCGTCGCCGCCTTTGCGCGACGCCTG
CCGGCACAGGTCCTGGCGGAATTCCTCGGGCTGCCCGCAGCCGCGCGCAGCCGGTTCGAG
GAACTGCTGGCCGGCTGCGCCCACAGCCTCGACAGCCGGCTCTGTCCGCAGACGCTCGAC
ATCACACGGACCGGCCTCGGAGCGGCGGCCGAGCTCCGGGAACTGCTCGCGCGCCACCTC
GGCGGGAGCGGACCACGCTCCGCTCAAGCGGCAGTCTCCCTGGCAGTCGAGGTGGCCGCA
CCCGCCGGCGCGCTCATCTGCAACGCGGTCGAGGCGCTGAGCAGCTCTCCCGGGCAGTGG
AACGCCCTCCGCCAGAACCCGGAGAAGGCCGACGCCGTCGTGGCGGAGACCTGGTGGCGA
CGACCGCCGGTGCGGGTGGAGAGCCGGATCGCCCAGGAGGACGTCGACGTGGCCGGAGTG
CCCGTCCCCGCGGACGGGCACGTGGCGATCCTCGTCGCCGCCGCCCAGCGCGACCCGGCG
ATCACCCCGGCCCCGACGAAGGACGACACCGGCACCCCCGGACAGGGCGACTGCGGCGTG
CCCCTGGGGCTCGTCGGCGACGCGCACGCCACCTCCGCCGCCCGGACGGTCCGCGCCCTC
TGCCGCGGTGCGCTGCGAGCGCTCGCGCAGGAGGCACCGGGCCTGCGGCCGAACGGGACC
CCGGTGCGCCTCAGGCGGGCACCCGTCACGCTCGGCCACGCCCGCTTCCCCGTCGCCCGG
ACGGGCCGGGGGACACCGACCGACGCGGGCGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [36-399]  3.90000000000001e-29 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [43-327]  3.0999994589937e-24 SSF48264
SSF48264   Cytochrome_P450
SignalP
 [1-25]  0.39 Signal
Bacteria, Gram-negative   
TMHMM No significant hit