close all open/close all

CDS information : Chalc_00270


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction64,804 / 66,081 / + [in whole cluster]
64,804 / 66,081 / + [in contig]
Location64804..66081 [in whole cluster]
64804..66081 [in contig]
TypeCDS
Length1,278 bp (425 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative chalcose glycosyltransferase
Gene
Gene (GenBank)chmCIII
EC number
Keyword
  • D-chalcose
Note
Note (GenBank)
  • similar to EryCIII, TylMII and DesVII
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331Q0
PmId
[18612242] Characterization of a chalcosyltransferase (gerGTII) in dihydrochalcomycin biosynthesis. (Mol Cells. , 2008)
ACC
Q9ZGH7
NITE
Pikro_00090
PmId
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative chalcose glycosyltransferase]
MRVLMTSIAHNTHYYHLVPLAWALKAAGHEVRVAGQPRVTDIITGSGLTAVPVGDDEDMM
ELFAEIGGDITPYQEGLDFAEERPEARSWEHLLGQQTVLTSLCFAPLNGDSTMDDIVALA
RSWQPDLVIWEPFTFAGAVAAHAVGAAHARVLWGPDVIGRARERFVEAKAQQAPEHREDP
MAEWLGWTLERLGLPAAGDGMEELLNGQWVIDPGPESVRLDLREPILPMRFVPYNGPAVV
PGWLSEKPKRPRVCLTQGVSGRETHGKDAVRFQDLLAALGDLDIEIVATLDSTQRENLTE
VPDNVRIVDFVSMDVLLPSCAMIIYHGGAGTSATALLHGVPQVVIGAHWDVPVRARQLDD
LGAGIFIRPEDLDAATLRAAVQRVLTEPSLQRAADRLRAEMRSNPTPAETVTVLERLSRS
HRQPR
selected fasta
>putative glycosyltransferase [putative chalcose glycosyltransferase]
ATGCGCGTCCTGATGACGTCGATCGCCCACAACACGCACTACTACCACCTGGTGCCGCTC
GCCTGGGCCCTGAAGGCCGCGGGCCACGAGGTGCGCGTCGCCGGCCAGCCCCGCGTCACG
GACATCATCACCGGGTCCGGACTGACCGCCGTGCCGGTCGGTGACGACGAGGACATGATG
GAGCTGTTCGCCGAGATCGGCGGAGACATCACCCCCTATCAGGAGGGACTGGACTTCGCC
GAGGAGCGGCCCGAGGCACGGTCCTGGGAACATCTGCTCGGACAGCAGACCGTTCTGACC
TCGCTGTGCTTCGCACCGCTCAACGGCGACTCGACGATGGACGACATCGTCGCGCTGGCC
CGCTCCTGGCAGCCGGACCTGGTGATCTGGGAACCCTTCACCTTCGCCGGAGCGGTCGCC
GCCCACGCCGTGGGCGCGGCGCACGCCCGCGTCCTGTGGGGTCCCGATGTCATCGGCCGG
GCCCGGGAACGGTTCGTGGAGGCCAAGGCACAGCAGGCTCCCGAACACCGGGAGGACCCG
ATGGCCGAGTGGCTCGGCTGGACCCTGGAGAGGCTGGGCCTCCCGGCCGCCGGAGACGGG
ATGGAGGAGTTGCTGAACGGCCAGTGGGTCATCGACCCGGGCCCGGAGAGCGTCCGGCTC
GACCTTCGCGAGCCGATCCTGCCCATGCGTTTCGTTCCCTACAACGGACCTGCCGTCGTC
CCCGGATGGCTGTCCGAGAAGCCGAAGCGACCGCGCGTCTGCCTCACCCAGGGAGTGTCG
GGACGCGAGACCCACGGCAAGGACGCCGTCCGCTTCCAGGACCTGCTCGCGGCGCTCGGC
GACCTCGACATCGAGATCGTCGCCACCCTGGACAGCACCCAGCGGGAGAACCTGACGGAG
GTCCCCGACAACGTCCGGATCGTCGACTTCGTCTCGATGGACGTGCTGCTGCCGAGTTGC
GCCATGATCATCTACCACGGTGGCGCCGGCACCTCGGCGACGGCCCTCCTGCACGGCGTT
CCGCAGGTCGTCATCGGAGCGCACTGGGACGTGCCGGTCAGGGCACGGCAGCTCGACGAC
CTGGGCGCCGGCATCTTCATCCGGCCCGAGGACCTCGACGCCGCCACACTGCGCGCGGCG
GTTCAGCGCGTGCTCACCGAGCCCTCCCTCCAGCGGGCCGCGGACCGGCTGCGGGCCGAG
ATGCGCTCCAACCCCACGCCGGCCGAGACCGTCACGGTGCTGGAGCGGCTCTCCCGGAGC
CACCGACAGCCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-97]  5.20000000000001e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [211-306]  5.10000000000004e-35 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit