close all open/close all

CDS information : Chalc_00280


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction66,194 / 66,940 / + [in whole cluster]
66,194 / 66,940 / + [in contig]
Location66194..66940 [in whole cluster]
66194..66940 [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative post-PKS ketoreductase
Gene
Gene (GenBank)chmU
EC number
Keyword
Note
Note (GenBank)
  • similar to putative 3-oxoacyl-acyl carrier protein reductase family; similar to SimJ2, NovJ, and Pseudomonas putida PP2783
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
P51831
PmId
[8759840] Bacillus subtilis acyl carrier protein is encoded in a cluster of lipid biosynthesis genes. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative post-PKS ketoreductase]
MEFEGQVALVTGAGRGIGRATVVRLAEAGCDIALHYNQAKAQAEEVAERIAALGRTVELF
PGDLSRPETGRQLVAAVQQKFDRIDILVNSAGITRDKLLLSMEADDIHQVIATNLVGPMF
LTQAVALTMLRQRSGRIVNISSAAASRPGKGQSNYAASKAGLEAFTRAMAVELGSRGILV
NAVAPGIVKTGLTEALREGAEPELLARQVIGSFAEPEAVAEAVAYLASPRNTHTTGTVLT
VDGGLKMV
selected fasta
>putative oxidoreductase [putative post-PKS ketoreductase]
ATGGAATTCGAAGGTCAGGTCGCGCTCGTCACCGGGGCCGGCAGGGGGATCGGCCGTGCG
ACGGTCGTCCGCCTCGCGGAGGCCGGATGTGACATCGCCCTCCACTACAACCAAGCGAAA
GCGCAGGCCGAGGAAGTCGCCGAGCGCATCGCCGCACTGGGCCGCACGGTCGAACTGTTC
CCGGGCGACCTCTCCCGCCCCGAGACCGGGCGACAGCTCGTGGCCGCGGTGCAGCAGAAG
TTCGACCGGATCGACATCCTGGTGAACAGCGCGGGCATCACACGGGACAAACTCCTGCTG
TCCATGGAGGCGGACGACATCCACCAGGTCATCGCCACCAACCTCGTCGGCCCGATGTTC
CTCACCCAGGCGGTCGCGCTCACCATGCTGCGTCAACGCTCCGGGCGCATCGTCAACATC
TCCTCCGCCGCCGCGAGCAGGCCCGGAAAGGGCCAGTCCAACTACGCCGCGTCCAAGGCC
GGTCTGGAGGCCTTCACCAGGGCCATGGCGGTGGAACTCGGATCCCGCGGAATTCTCGTC
AACGCGGTCGCTCCCGGCATCGTCAAGACCGGCCTGACCGAGGCTCTCCGCGAGGGGGCG
GAGCCCGAACTCCTGGCCCGGCAGGTGATCGGTTCCTTCGCCGAACCCGAGGCGGTGGCG
GAGGCGGTGGCCTACTTGGCGAGCCCGCGCAACACGCACACGACGGGCACGGTCCTCACC
GTCGACGGCGGGCTCAAGATGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  7.30000590915208e-14 PR00080 [135-143]  7.30000590915208e-14 PR00080 [155-174]  7.30000590915208e-14 PR00080
PR00080   SDRFAMILY
 [7-173]  1.5e-39 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  1.10000150671643e-42 PR00081 [82-93]  1.10000150671643e-42 PR00081 [129-145]  1.10000150671643e-42 PR00081 [155-174]  1.10000150671643e-42 PR00081 [176-193]  1.10000150671643e-42 PR00081 [209-229]  1.10000150671643e-42 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-246]  9.9e-83 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit