close all open/close all

CDS information : Chalc_00290


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction68,471 / 67,323 / - [in whole cluster]
68,471 / 67,323 / - [in contig]
Locationcomplement(67323..68471) [in whole cluster]
complement(67323..68471) [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative permease
Gene
Gene (GenBank)ORF4
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC0513
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [putative permease]
MSASLSPARTRAALRASARISTELLLVLLGTAAVIWLLGRMWSIVWPLVIGLLITTLTWP
FARLLRRLGWPPALAASVVTVLFLAVTAGTVALIAVPVASQSGELADGVVEGIQRLREWT
AGPPLNIGDDQITGALDTATDRLQNSVGSLLTTLATGVGTVVNGVVTAVLALFLMFFFLK
DGPRFLPWLARQLPGRLATDATTIAERGWDTLGAFVRSQAAVGLLDAVLIGIGLWILGVP
LVLPLAVLTFVSAFVPIIGALLAGFVAVLIALVSNGLTDALIVLAIIVVVQQLEGNVFQP
MIQSRGLGLHAAVVLLAVTLGGSLAGIVGSLLAVPVAALVAVVWGYVREQLSDPPQLDAD
GGTRPGPDGAPESVVPAEIPAS
selected fasta
>hypothetical protein [putative permease]
ATGTCTGCCTCTCTCAGTCCTGCGAGAACACGTGCCGCGCTACGGGCCTCGGCCCGCATA
TCGACGGAGCTTCTGCTGGTGCTCTTGGGCACGGCGGCGGTGATCTGGCTGCTCGGCCGG
ATGTGGTCGATCGTGTGGCCACTCGTCATCGGTCTGCTGATCACCACGCTGACCTGGCCC
TTCGCCCGCTTGTTGCGCCGTCTCGGCTGGCCGCCGGCGCTCGCCGCCTCGGTGGTCACC
GTCCTCTTCCTCGCCGTCACCGCCGGCACCGTCGCGCTCATCGCCGTGCCCGTCGCCTCG
CAGTCCGGCGAACTGGCCGACGGTGTCGTCGAGGGCATCCAGCGTCTCCGCGAGTGGACC
GCGGGTCCGCCCCTGAACATCGGCGACGACCAGATCACCGGCGCCCTGGACACCGCGACC
GACCGTCTCCAGAACAGCGTCGGATCCCTGCTGACCACCCTCGCCACCGGCGTCGGCACG
GTGGTGAACGGGGTCGTCACGGCCGTCCTCGCGCTCTTCCTGATGTTCTTCTTCCTCAAG
GACGGGCCGCGCTTCCTGCCCTGGCTCGCCCGTCAGCTCCCCGGCCGCCTCGCGACCGAC
GCCACCACGATCGCCGAACGCGGCTGGGACACCCTCGGCGCCTTCGTCCGCTCCCAGGCC
GCGGTGGGCCTCCTCGACGCCGTCCTCATCGGCATCGGCCTGTGGATCCTCGGCGTCCCG
CTCGTCCTGCCGCTCGCCGTACTCACCTTCGTCAGCGCCTTCGTGCCGATCATCGGCGCG
CTGTTAGCAGGATTCGTCGCCGTGCTCATCGCCCTGGTCTCCAACGGCCTGACCGACGCC
CTGATCGTGCTCGCGATCATCGTGGTGGTGCAGCAGCTGGAGGGGAACGTCTTCCAGCCC
ATGATCCAGAGCCGCGGACTCGGACTGCACGCCGCCGTCGTCCTGCTCGCCGTCACCCTG
GGCGGCAGTCTGGCGGGCATCGTCGGCAGCCTCCTCGCCGTGCCCGTCGCCGCCCTCGTC
GCCGTGGTGTGGGGGTACGTGCGCGAGCAGCTCTCCGATCCGCCGCAGCTCGACGCCGAC
GGTGGCACGAGGCCCGGCCCCGACGGCGCCCCCGAGTCCGTCGTCCCGGCGGAGATCCCG
GCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002549 Uncharacterised protein family UPF0118 (Family)
 [26-342]  1.29999999999998e-57 PF01594
PF01594   UPF0118
SignalP
 [1-43]  0.818 Signal
Eukaryota   
 [1-32]  0.457 Signal
Bacteria, Gram-positive   
TMHMM
 [20-39]  Transmembrane (i-o) [43-65]  Transmembrane (o-i) [78-100]  Transmembrane (i-o) [157-179]  Transmembrane (o-i) [221-243]  Transmembrane (i-o) [247-269]  Transmembrane (o-i) [271-293]  Transmembrane (i-o) [313-347]  Transmembrane (o-i)
Transmembrane 8