close all open/close all

CDS information : Chalc_00300


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction70,196 / 68,733 / - [in whole cluster]
70,196 / 68,733 / - [in contig]
Locationcomplement(68733..70196) [in whole cluster]
complement(68733..70196) [in contig]
TypeCDS
Length1,464 bp (487 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ORF5
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC2255, SC3592, and SC7017, Streptomyces avermitilis SAV5946
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [conserved hypothetical protein]
MTATTRRDPAAVPDGGTAEPVPSPAAPDGRAAQTVPSPAAPDSGAAESAPSTAADGRAEQ
TVCSLAADGTADGRGRAPGAAVGVGDAGPRRRWWRRRGAAVTGCSVFLAAPDGRAAQTVP
SPAAPDSGAAESAPSTAADGRAEQTVCSLAADGTADGRGRAPGAAVGVGDAGPRRRWWRR
RGAAVTGCSVFLAVSVAGHGRLPGLPGRLSSLAETLLPWSALAVPVLVTAALLWRARVAA
VVALVVPAVAWLTAFGGALTDKTTPGGDLTLVSHNVEQANPDPAGTVRSLLAAGADVLAL
EELSPATAPAYERALAESYPYHFYEGTVGLWSVHPLSDARAVPIMPWTRAMRATVDAPGG
PLAVYVAHLPSVRVGPGGFTAGARDEALGLLAAEVRAEPVRRVVLLGDLNGSTDDRALRP
LTDRLVSAQAAAGAGFGFTWPARLPVVRIDQILLGGVRAASAWTLPATASDHLPVAARIH
LAPDPAP
selected fasta
>hypothetical protein [conserved hypothetical protein]
ATGACGGCGACGACACGCCGGGATCCGGCCGCGGTGCCGGACGGCGGGACGGCGGAGCCC
GTCCCCTCCCCCGCGGCGCCGGACGGCAGGGCGGCACAGACTGTCCCCTCCCCCGCGGCG
CCGGACAGCGGGGCAGCGGAGAGCGCCCCCTCCACTGCGGCGGACGGCAGGGCGGAACAG
ACCGTCTGCTCCCTGGCTGCGGACGGCACGGCGGACGGCAGGGGCCGCGCTCCCGGAGCC
GCGGTCGGCGTGGGGGACGCCGGTCCGCGCCGGCGGTGGTGGCGACGCCGCGGGGCGGCG
GTCACGGGCTGTTCCGTCTTCCTCGCGGCGCCGGACGGCAGGGCGGCACAGACTGTCCCC
TCCCCCGCGGCGCCGGACAGCGGGGCAGCGGAGAGCGCCCCCTCCACTGCGGCGGACGGC
AGGGCGGAACAGACCGTCTGCTCCCTGGCTGCGGACGGCACGGCGGACGGCAGGGGCCGC
GCTCCCGGAGCCGCGGTCGGCGTGGGGGACGCCGGTCCGCGCCGGCGGTGGTGGCGACGC
CGCGGGGCGGCGGTCACGGGCTGTTCCGTCTTCCTCGCGGTGAGCGTCGCGGGCCATGGG
CGGCTCCCCGGACTGCCCGGACGGCTGAGCAGTCTGGCAGAGACCTTGCTGCCCTGGAGC
GCGCTGGCCGTGCCCGTGCTGGTGACCGCGGCCCTGCTGTGGCGCGCGCGGGTGGCGGCG
GTGGTGGCCCTGGTGGTGCCGGCCGTGGCCTGGCTGACGGCCTTCGGCGGAGCGCTGACC
GACAAGACGACGCCCGGTGGGGACCTCACGCTGGTCAGTCACAACGTCGAGCAGGCCAAC
CCCGACCCCGCCGGAACGGTGCGGAGCCTGCTCGCCGCCGGGGCGGACGTACTGGCGTTG
GAGGAGCTGAGCCCGGCCACGGCGCCCGCCTACGAGCGGGCCCTTGCGGAGTCGTACCCG
TACCACTTCTACGAGGGCACGGTGGGCTTGTGGAGCGTGCATCCGCTGAGCGACGCGCGG
GCTGTGCCGATCATGCCGTGGACGCGGGCGATGCGGGCCACGGTGGACGCGCCCGGCGGG
CCGCTGGCCGTCTATGTCGCCCATCTGCCGTCCGTCCGCGTGGGCCCGGGCGGATTCACC
GCCGGGGCGCGCGACGAGGCGCTGGGGCTGCTGGCGGCGGAGGTGCGGGCCGAGCCCGTC
CGGCGCGTCGTCCTCCTGGGCGACCTCAACGGCTCCACGGACGACCGCGCACTGCGCCCC
CTCACCGACCGTCTCGTCTCCGCACAGGCCGCGGCGGGCGCGGGCTTCGGCTTCACCTGG
CCGGCGCGCCTGCCGGTCGTCCGGATCGACCAGATCCTTCTCGGGGGCGTCCGGGCCGCC
TCGGCATGGACCCTTCCCGCGACGGCCAGCGACCACCTCCCGGTAGCGGCCCGTATCCAC
CTCGCCCCGGACCCCGCTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005135 Endonuclease/exonuclease/phosphatase (Domain)
 [273-472]  1.5e-11 PF03372
PF03372   Exo_endo_phos
 [266-481]  8.20001307135067e-26 SSF56219
SSF56219   Exo_endo_phos
SignalP
 [1-10]  0.476 Signal
Bacteria, Gram-negative   
 [1-18]  0.047 Signal
Eukaryota   
TMHMM
 [183-205]  Transmembrane (i-o) [215-234]  Transmembrane (o-i) [241-260]  Transmembrane (i-o)
Transmembrane 3