close all open/close all

CDS information : Chalc_00310


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction71,146 / 70,193 / - [in whole cluster]
71,146 / 70,193 / - [in contig]
Locationcomplement(70193..71146) [in whole cluster]
complement(70193..71146) [in contig]
TypeCDS
Length954 bp (317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S11 family peptidase
Product (GenBank)putative D-alanyl-D-alanine carboxypeptidase
Gene
Gene (GenBank)ORF6
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in meilingmycin biosynthesis.
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • similar to Streptomyces coelicolor SC4439, and Streptomyces avermitilis SAV3781
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
P33013
PmId
[8955390] dacD, an Escherichia coli gene encoding a novel penicillin-binding protein (PBP6b) with DD-carboxypeptidase activity. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative S11 family peptidase [putative D-alanyl-D-alanine carboxypeptidase]
MSLPRTPRHRLVGGALSVALLTALGITVASPSGAPPAAGGERLPVSDIGPLPWPQDGQSA
VELEGTGSLGERGERRPVPIASLTKVMTAYVILEEHPLRPDEDGPLIEVDRTAAHEAGVG
GESTVPVRSGERHSQRRLLELLLIPSGNNVARLLARWDSGSQAAFVTKMRRAAVRLGMKD
TVYTGASGIEPTTTSTAADQVRLTRAAMEDPVFRAVVATRETTVPGLGTITNTNPLLDTP
GVLGVKTGSSTPAGGNLLWAYEVRVGGAPRLLVGAVLHQRANTTPAEGLRAAVEAARGLL
TAVRERLAAAGTQGGER
selected fasta
>putative S11 family peptidase [putative D-alanyl-D-alanine carboxypeptidase]
GTGTCCCTGCCCCGCACCCCCCGTCACCGCCTCGTCGGCGGTGCCCTGTCCGTGGCCCTG
CTGACGGCCCTGGGCATCACCGTCGCCTCGCCCTCCGGCGCGCCTCCGGCGGCGGGAGGC
GAGCGACTACCGGTCTCCGACATCGGGCCGCTCCCCTGGCCGCAGGACGGCCAGAGCGCC
GTCGAGCTCGAAGGAACCGGCTCGCTGGGCGAGCGGGGCGAGCGGCGGCCCGTACCGATC
GCGAGCCTGACGAAGGTGATGACCGCCTACGTCATCCTCGAAGAGCATCCGCTGAGGCCC
GACGAGGACGGCCCCCTGATCGAAGTGGACCGGACGGCCGCGCACGAGGCGGGGGTCGGC
GGCGAGTCGACCGTCCCGGTACGGTCCGGCGAACGCCACTCCCAGCGCCGGCTCCTGGAA
CTGCTCCTCATCCCCTCCGGCAACAACGTCGCCCGTCTGCTGGCCCGCTGGGACTCCGGC
AGCCAGGCGGCCTTCGTGACGAAGATGCGGCGCGCCGCCGTACGGCTCGGGATGAAGGAC
ACGGTCTACACGGGGGCGAGCGGCATCGAGCCGACGACCACAAGCACCGCGGCCGACCAG
GTGCGGCTGACGCGGGCCGCGATGGAGGACCCTGTCTTCCGGGCGGTCGTCGCCACCCGC
GAGACCACCGTCCCGGGCCTCGGGACGATCACCAACACCAATCCCCTGCTGGACACCCCG
GGCGTCCTCGGTGTGAAGACGGGCTCCAGCACCCCGGCGGGCGGGAACCTCCTGTGGGCC
TACGAGGTGCGCGTGGGCGGCGCGCCCCGGCTGCTGGTGGGCGCCGTCCTGCACCAGCGG
GCGAACACGACGCCCGCCGAGGGGCTCCGGGCCGCGGTCGAGGCGGCCCGTGGCCTGCTC
ACCGCCGTCCGCGAGCGGCTGGCCGCCGCCGGAACCCAGGGCGGGGAACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001967 Peptidase S11, D-alanyl-D-alanine carboxypeptidase A, N-terminal (Domain)
 [68-258]  9.1e-31 PF00768
PF00768   Peptidase_S11
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [70-263]  3.3e-46 G3DSA:3.40.710.10
G3DSA:3.40.710.10   no description
 [7-307]  2.2e-40 SSF56601
SSF56601   beta-lactamase/transpeptidase-like
IPR018044 Peptidase S11, D-alanyl-D-alanine carboxypeptidase A (Family)
 [81-92]  6.9e-13 PR00725 [138-155]  6.9e-13 PR00725 [165-178]  6.9e-13 PR00725
PR00725   DADACBPTASE1
SignalP
 [1-39]  0.998 Signal
Bacteria, Gram-negative   
 [1-34]  1 Signal
Bacteria, Gram-positive   
 [1-29]  0.962 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1