close all open/close all

CDS information : Chalc_00320


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction72,542 / 71,382 / - [in whole cluster]
72,542 / 71,382 / - [in contig]
Locationcomplement(71382..72542) [in whole cluster]
complement(71382..72542) [in contig]
TypeCDS
Length1,161 bp (386 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)sensory histidine kinase
Gene
Gene (GenBank)ORF7
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC5304, SC3359 and Streptomyces avermitilis SAV2950 and SAV4703
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ZEP3
PmId
[10411727] A putative two-component signal transduction system regulates sigmaE, a sigma factor required for normal cell wall integrity in Streptomyces coelicolor A3(2). (Mol Microbiol. , 1999)
Family/Domain
FD
IPR005467, IPR003661

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [sensory histidine kinase]
MALTVGVLVHDSVLRRSLHEGAGRAHVALATALEDADAAGEEGPRVSPEELPEALLRQIE
HGGEATLYEDGPPAPVFRAARREGGKLYAVEVDMTADLLTRQALDRHMWKYSLLTLGVVV
PATALATELPARRLRRVARTARRITAGDLDARTGTVRGGDEVAEISAVVDSMADSLQQRI
DTEQRFTADVAHELRTPLMGLVTSAELLPEGEVTDMVQSRVRVLRDLVEDLLEVSRLDAG
AETAQQGPVDLGALVRDSVARTGLAAQVTRQGAAVVESDPRRLDRIVSNLVVNAHRHGAG
RVEVTVAGRTVTVRDHGPGFPADLLSHGPQRFRTGSAERGHGHGLGLTIASGQARVIGAT
LAFANARDGGAVATLSLPEDGQTSEA
selected fasta
>putative two-component system histidine kinase [sensory histidine kinase]
ATGGCGCTGACCGTCGGAGTGCTGGTGCACGACTCGGTGCTGCGGCGCTCCCTGCACGAG
GGCGCGGGCAGGGCCCACGTGGCGCTGGCAACGGCCTTGGAGGACGCCGACGCAGCAGGT
GAGGAAGGGCCCCGGGTGTCCCCCGAGGAACTGCCCGAGGCCCTGCTGAGGCAGATCGAG
CACGGCGGCGAGGCCACCCTCTACGAGGACGGGCCCCCGGCCCCCGTCTTCCGGGCGGCC
CGCCGGGAGGGCGGGAAGCTGTACGCGGTCGAGGTCGACATGACCGCCGACCTGCTGACC
CGGCAGGCCCTGGACCGTCACATGTGGAAGTACTCGCTGCTCACCCTGGGCGTCGTCGTC
CCCGCCACGGCCCTGGCGACGGAACTCCCCGCCCGGCGGCTGCGCCGGGTCGCCCGCACG
GCCCGGCGCATCACGGCGGGCGACCTCGACGCCCGGACGGGAACGGTCCGCGGAGGCGAC
GAGGTCGCCGAGATCTCGGCCGTGGTCGACTCGATGGCCGACAGCCTCCAGCAGCGGATC
GACACCGAGCAGCGCTTCACCGCCGACGTCGCACACGAGCTGCGCACCCCGCTGATGGGC
CTGGTCACCTCGGCGGAACTGCTGCCCGAGGGCGAGGTGACGGACATGGTCCAGAGCCGG
GTACGGGTGCTGCGCGACCTGGTGGAGGACCTCCTGGAGGTCTCCCGGCTCGACGCGGGC
GCCGAGACGGCCCAGCAGGGACCGGTCGACCTGGGCGCCCTCGTCCGGGACTCGGTGGCG
CGGACGGGCCTCGCGGCGCAGGTGACGCGACAGGGGGCGGCAGTGGTCGAGTCGGACCCC
CGGCGCCTGGACCGCATCGTCTCCAACCTCGTCGTCAACGCCCACCGGCACGGCGCGGGT
CGGGTGGAGGTCACGGTCGCCGGCCGGACCGTGACCGTCCGGGACCACGGCCCCGGCTTC
CCCGCCGACCTGCTGTCCCACGGCCCCCAGCGGTTCCGCACGGGCTCGGCCGAACGGGGG
CACGGGCACGGCCTTGGCCTGACGATCGCGTCCGGCCAGGCGAGGGTGATCGGCGCGACC
CTGGCCTTCGCCAACGCCCGGGACGGAGGAGCGGTCGCGACCCTGAGCCTGCCCGAGGAC
GGGCAGACGTCCGAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [227-380]  1.4e-24 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [279-379]  1.4e-14 PF02518
PF02518   HATPase_c
 [278-381]  2.30000440726534e-21 SM00387
SM00387   HATPase_c
 [229-378]  4.19999771339581e-26 SSF55874
SSF55874   ATP_bd_ATPase
IPR003660 HAMP linker domain (Domain)
 [112-178]  1.7e-09 PF00672
PF00672   HAMP
 [128-181]  PS50885
PS50885   HAMP
 [128-181]  1.30000067202732e-08 SM00304
SM00304   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [182-240]  6.50000805230168e-18 SM00388
SM00388   HisKA
 [184-240]  7e-13 PF00512
PF00512   HisKA
IPR005467 Signal transduction histidine kinase, core (Domain)
 [189-381]  PS50109
PS50109   HIS_KIN
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [164-242]  5.59999989417023e-15 SSF47384
SSF47384   His_kin_homodim
SignalP No significant hit
TMHMM No significant hit