close all open/close all

CDS information : Chalc_00330


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction73,324 / 72,638 / - [in whole cluster]
73,324 / 72,638 / - [in contig]
Locationcomplement(72638..73324) [in whole cluster]
complement(72638..73324) [in contig]
TypeCDS
Length687 bp (228 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system response regulator
Product (GenBank)putative two-component system response regulator
Gene
Gene (GenBank)ORF8
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC3358, and Streptomyces avermitilis SAV4704
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ZEP4
PmId
[10411727] A putative two-component signal transduction system regulates sigmaE, a sigma factor required for normal cell wall integrity in Streptomyces coelicolor A3(2). (Mol Microbiol. , 1999)
Family/Domain
FD
IPR001789, IPR001867

close this sectionSequence

selected fasta
>putative two-component system response regulator [putative two-component system response regulator]
MTVLLVEDDEVIRRSVAMSLERYGYRVRVAADGLTGLELFREGRHDLVLLDVMLPGLDGI
GLCRRIRETATDPILMMSARGDALDVVSGLEAGADDYVVKPVDTAVLVARIRSLLRRAAF
VSPAPGPADPATPAGPLLFGDLSLDPAALEVRRGGERIALAPTELRLLLQFAAHPGIVLD
RQTLLREVWDYGWDGDTRVVDLCVQRLRKKIGAERVETVRGFGYKWKR
selected fasta
>putative two-component system response regulator [putative two-component system response regulator]
GTGACCGTCCTGCTGGTCGAGGACGACGAGGTGATCCGGCGGTCCGTCGCGATGTCCCTG
GAGCGCTACGGCTACCGCGTGCGCGTCGCGGCCGACGGACTGACCGGGCTCGAACTCTTC
CGGGAGGGACGGCACGACCTGGTGCTGCTCGACGTGATGCTGCCGGGCCTGGACGGCATC
GGACTGTGCCGGCGCATCCGGGAGACGGCCACGGACCCGATCCTGATGATGTCGGCGCGC
GGTGACGCCCTCGACGTGGTGTCCGGCCTGGAGGCCGGGGCCGACGACTACGTGGTGAAG
CCCGTCGACACCGCCGTCCTGGTGGCGCGCATCCGTTCGCTGCTGCGCCGGGCCGCCTTC
GTGTCCCCCGCCCCCGGACCCGCCGACCCCGCGACGCCGGCCGGCCCGCTGCTCTTCGGC
GACCTCTCCCTCGACCCCGCGGCCCTGGAGGTCCGCCGGGGCGGCGAGCGGATCGCGCTC
GCCCCGACCGAGCTGCGGCTGCTGCTCCAGTTCGCCGCGCACCCCGGGATCGTGCTGGAC
CGTCAGACCCTCCTGCGCGAGGTGTGGGACTACGGCTGGGACGGGGACACCCGGGTCGTC
GACCTGTGCGTGCAGCGGCTGCGCAAGAAGATCGGCGCCGAGCGCGTCGAGACGGTCCGG
GGCTTCGGCTACAAGTGGAAGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-111]  4.10000000000001e-28 PF00072
PF00072   Response_reg
 [2-115]  PS50110
PS50110   RESPONSE_REGULATORY
 [1-111]  3.80000697093588e-46 SM00448
SM00448   REC
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [155-226]  2.80000000000001e-20 PF00486
PF00486   Trans_reg_C
 [155-226]  9.59999914716171e-24 SM00862
SM00862   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-197]  2.19999900980707e-41 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [137-227]  5.69999999999998e-27 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit