close all open/close all

CDS information : Chalc_00350


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction76,117 / 75,401 / - [in whole cluster]
76,117 / 75,401 / - [in contig]
Locationcomplement(75401..76117) [in whole cluster]
complement(75401..76117) [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ORF10
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC5427, Streptomyces avermitilis SAV2821
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [conserved hypothetical protein]
MPPADDPYALPRFDPTRAAAVRAQLGLTLGQVAWAVTAYCGHPAHPGLVEAWEAGTATPD
NTQVKALAAALWCSPVDLVEEPGTLAQCRTVAGLTVNETATELGLTRGQWEDAERRNRWQ
GTPAQTDALLRVLCPPPACFVAACGRTGRLRVLLREAATTWWPPYVGALSRIVPLDPAVL
GHALERLHLTYQQWEGAAGGPPRQAARAEARAADFLEHIDLHLWHHVREVLNPARPAS
selected fasta
>hypothetical protein [conserved hypothetical protein]
ATGCCACCCGCAGACGATCCGTATGCCCTGCCCCGCTTCGATCCCACCCGTGCCGCGGCC
GTCCGCGCCCAGCTCGGCCTGACGCTCGGCCAGGTCGCCTGGGCCGTCACCGCCTACTGC
GGACACCCCGCGCACCCCGGCCTCGTCGAGGCGTGGGAAGCCGGCACCGCCACCCCCGAC
AACACCCAGGTGAAGGCCCTCGCGGCGGCCCTCTGGTGCTCTCCGGTCGATCTCGTCGAA
GAGCCCGGCACCCTCGCCCAGTGCCGTACCGTCGCCGGACTCACCGTCAACGAGACCGCG
ACCGAGCTCGGCCTCACCCGCGGCCAGTGGGAGGACGCCGAACGCCGGAACCGCTGGCAG
GGGACCCCCGCCCAGACGGACGCCCTCCTGAGAGTCCTCTGCCCGCCACCGGCCTGCTTC
GTCGCCGCGTGCGGCAGGACCGGCCGGCTCCGCGTCCTGCTCAGAGAGGCCGCCACCACC
TGGTGGCCCCCCTACGTGGGGGCCCTTTCCCGCATCGTGCCGCTCGACCCCGCCGTACTC
GGCCACGCCCTCGAACGCCTCCACCTCACCTACCAGCAATGGGAGGGCGCGGCCGGCGGC
CCGCCCCGTCAGGCGGCCCGCGCGGAGGCCCGGGCGGCGGACTTCCTCGAACACATCGAC
CTGCACCTCTGGCACCACGTCCGGGAGGTCCTCAACCCGGCCCGTCCCGCCTCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [20-80]  3.9e-07 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-35]  0.41 Signal
Bacteria, Gram-negative   
 [1-35]  0.488 Signal
Bacteria, Gram-positive   
TMHMM No significant hit