close all open/close all

CDS information : Chalc_00360


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction76,537 / 78,375 / + [in whole cluster]
76,537 / 78,375 / + [in contig]
Location76537..78375 [in whole cluster]
76537..78375 [in contig]
TypeCDS
Length1,839 bp (612 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative xanthine permease
Product (GenBank)putative permease
Gene
Gene (GenBank)ORF11
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SC6214 and SC6212, Streptomyces avermitilis SAV2016 and SAV1508 xanthine/uracil permease homology family member
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
P42086
PmId
[9098051] Xanthine metabolism in Bacillus subtilis: characterization of the xpt-pbuX operon and evidence for purine- and nitrogen-controlled expression of genes involved in xanthine salvage and catabolism. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative xanthine permease [putative permease]
MSQGPALLPRATDHASPTPPHPVDEILPARRMLPAALQHVASMYAGLTAPPLIISSALGL
TPAQLSALLAAALLIAGLGTIAQTLGVYGVGAGLPLVNGVSFAVVSPALATAATQGRDGA
LPAIFGATLVAGLLCLLLAPVFCRLVRFFPPVVSGCVITLVGISLLPVAGTWARGGDAEA
AGFGSPADLALAATTLVITLTVHRMLSGRFLGRVAILIGMLAGTLIAIPLGKVDLDPLAQ
APLFALPTPFGFGTPQFVPTVIATAAVVMIVSMMESTAALLALGAVAERPVRDRTIAGSL
RALGLATVLGGVLGSFTSTSYAQNVGLVSLSRIRSRYVVTLCGAVLVLMGFVPVLGSFVA
LVPLPVLGGAGVVFFGSVAVTGIRTLAKAALGTGHNAVIVSVTLAFGLFPVLDPDFYARL
PAPVATVLGSGITAGCLVAVLLNYLLNHLGRGTEADPDAISAEQVTALDTADTVLGPKRS
SDWTPFQPSGSPSGTPDHGRHTRGTARPAPAWPYVTGPVDPTDTGRHHRPHEVPAPPHRP
DEVPPPLHPSAAHEGEPPPAVTENAVFPGPLHPLHPLHPRPTGRPDRPRQRHSAEADPWQ
HPQTPSASGDSQ
selected fasta
>putative xanthine permease [putative permease]
GTGTCTCAAGGACCTGCCTTGCTGCCCCGCGCCACTGACCACGCATCGCCGACCCCACCC
CATCCGGTCGACGAGATCCTTCCCGCCCGCCGCATGCTGCCCGCCGCCCTCCAACACGTG
GCGAGCATGTACGCCGGCCTGACCGCACCACCGCTGATCATCAGCAGCGCCCTGGGGCTG
ACCCCGGCCCAGCTCTCCGCCCTCCTGGCCGCCGCGCTGCTGATCGCCGGGCTCGGCACG
ATCGCCCAGACCCTCGGCGTCTACGGCGTCGGCGCCGGGTTGCCCCTCGTCAACGGCGTC
TCGTTCGCCGTCGTGTCACCGGCGCTCGCCACCGCCGCCACCCAGGGGCGCGACGGCGCC
CTCCCGGCGATCTTCGGGGCCACCCTCGTGGCGGGACTCCTCTGCCTGCTCCTCGCTCCC
GTCTTCTGCCGACTGGTCAGGTTCTTCCCACCGGTCGTCAGCGGCTGCGTCATCACCCTG
GTCGGCATCTCCCTCCTGCCGGTCGCCGGCACCTGGGCCCGGGGCGGAGACGCCGAAGCC
GCCGGCTTCGGCTCCCCCGCCGACCTGGCCCTGGCGGCGACGACCCTCGTCATCACCCTG
ACCGTGCACCGCATGCTCTCGGGCCGCTTCCTCGGGCGGGTCGCCATCCTCATCGGCATG
CTCGCGGGCACCCTGATCGCGATCCCGCTGGGCAAGGTCGACCTCGACCCCCTCGCCCAG
GCGCCCCTCTTCGCCCTGCCCACGCCCTTCGGCTTCGGCACCCCGCAGTTCGTCCCCACC
GTGATCGCCACCGCCGCGGTCGTGATGATCGTGTCCATGATGGAGTCCACCGCCGCGCTG
CTGGCGCTGGGCGCGGTCGCCGAACGGCCGGTCCGGGACCGGACCATCGCCGGAAGCCTC
CGCGCCCTCGGCCTCGCCACGGTCCTCGGCGGCGTCCTCGGCTCGTTCACCAGCACGTCG
TACGCGCAGAACGTCGGCCTGGTCTCCCTCAGCCGGATCCGCAGCCGCTATGTGGTCACG
CTCTGCGGCGCCGTCCTCGTCCTGATGGGCTTCGTGCCCGTCCTGGGCTCGTTCGTCGCC
CTCGTCCCTCTGCCCGTCCTCGGCGGTGCGGGGGTGGTCTTCTTCGGCTCCGTCGCCGTC
ACGGGCATCCGTACGCTGGCCAAGGCCGCCCTCGGCACCGGACACAACGCTGTGATCGTC
TCCGTCACCCTCGCCTTCGGTCTCTTCCCCGTCCTGGACCCGGACTTCTACGCCCGTCTT
CCCGCCCCGGTGGCGACCGTGCTCGGCTCGGGGATCACCGCCGGCTGCCTGGTCGCGGTC
CTCCTCAACTACCTCCTGAACCACCTGGGCCGCGGCACCGAGGCCGACCCCGACGCGATC
TCCGCGGAACAGGTCACCGCCCTCGACACCGCGGACACCGTCCTCGGGCCGAAGCGTTCC
TCCGACTGGACGCCCTTCCAGCCCTCCGGCAGCCCCTCCGGCACCCCTGACCACGGCCGT
CACACCAGGGGCACGGCACGGCCCGCTCCCGCCTGGCCCTACGTGACCGGCCCCGTGGAC
CCCACCGACACCGGGCGGCACCACCGGCCGCACGAGGTTCCGGCGCCGCCCCACCGACCA
GACGAGGTGCCCCCGCCGCTCCACCCCTCTGCCGCTCACGAAGGCGAACCCCCGCCCGCC
GTCACCGAGAACGCGGTCTTTCCCGGACCGCTCCACCCGCTCCACCCGCTCCACCCCCGG
CCCACCGGTCGTCCCGACCGTCCCCGGCAACGGCACAGTGCGGAGGCCGACCCCTGGCAG
CATCCGCAGACCCCCTCCGCATCCGGCGACAGCCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006042 Xanthine/uracil permease (Family)
 [31-444]  2.09999999999996e-93 TIGR00801
TIGR00801   Ncs2
IPR006043 Xanthine/uracil/vitamin C permease (Family)
 [32-414]  2.90000000000003e-83 PF00860
PF00860   Xan_ur_permease
IPR017588 Xanthine permease (Family)
 [36-447]  TIGR03173
TIGR03173   PbuX
SignalP No significant hit
TMHMM
 [53-75]  Transmembrane (o-i) [87-109]  Transmembrane (i-o) [119-141]  Transmembrane (o-i) [148-170]  Transmembrane (i-o) [180-202]  Transmembrane (o-i) [209-231]  Transmembrane (i-o) [262-284]  Transmembrane (o-i) [337-356]  Transmembrane (i-o) [361-383]  Transmembrane (o-i) [390-409]  Transmembrane (i-o) [424-446]  Transmembrane (o-i)
Transmembrane 11