close all open/close all

CDS information : Chalc_00370


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction78,521 / 79,192 / + [in whole cluster]
78,521 / 79,192 / + [in contig]
Location78521..79192 [in whole cluster]
78521..79192 [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative merR-family transcriptional regulator
Gene
Gene (GenBank)ORF12
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to S.coelicolor SCO7698
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [putative merR-family transcriptional regulator]
MTTVSAARHRAGGSPRGGTSRPGPDERIAQVVAEALGSARTVLDPDALPGLGTTRLPFGD
GRFDAAMMLCNAPGVPDALSRLGELRRVTRGPVVVLATDPSRVRSFWLDRYAPEVLAVEA
RRHPPIADLTAVLGGSAEVRSVPVPLDCTDTFDEAYYGRPEKLLDPSARQAGSAWSFVDD
RVREEFDTTLRRELRSGEWDERFGHLRRRPVYEGSLVIVRAVP
selected fasta
>hypothetical protein [putative merR-family transcriptional regulator]
ATGACCACCGTTTCCGCCGCCCGCCACCGTGCGGGCGGCTCCCCGCGCGGCGGCACGTCC
CGCCCGGGCCCCGACGAGAGAATCGCCCAGGTCGTGGCCGAGGCCCTCGGATCCGCCCGG
ACGGTCCTCGACCCGGATGCGCTGCCCGGCCTCGGCACCACGCGACTCCCGTTCGGCGAC
GGGAGGTTCGACGCGGCGATGATGCTCTGCAACGCCCCCGGCGTCCCCGACGCGCTCTCG
CGGCTCGGGGAACTGCGCCGCGTGACACGGGGCCCCGTCGTGGTCCTCGCGACCGACCCC
TCGCGCGTCCGCTCGTTCTGGCTGGACCGGTACGCCCCCGAGGTCCTGGCCGTCGAAGCG
CGGCGTCATCCGCCGATCGCCGATCTGACCGCCGTCCTCGGGGGTTCCGCCGAGGTGCGG
AGCGTCCCCGTTCCCCTCGACTGCACCGACACCTTCGACGAGGCGTACTACGGAAGACCC
GAGAAGCTCCTGGACCCGTCGGCCCGCCAGGCGGGGTCGGCCTGGAGCTTCGTGGACGAC
CGGGTCCGCGAGGAGTTCGACACGACCCTGCGCCGCGAACTCCGGTCGGGGGAGTGGGAC
GAGCGCTTCGGCCACCTCCGCCGCCGGCCCGTCTACGAGGGATCACTGGTGATCGTCCGT
GCCGTCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit