close all open/close all

CDS information : Chalc_00380


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction79,983 / 79,228 / - [in whole cluster]
79,983 / 79,228 / - [in contig]
Locationcomplement(79228..79983) [in whole cluster]
complement(79228..79983) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative type II thioesterase
Product (GenBank)thioesterase TEII family
Gene
Gene (GenBank)ORF13
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to RifR
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase TEII family]
MTTGTDSTTWFRRYSSTPAPRRRLAVLPHAGGSASFFHAWGSAFGGDTEVLVAQYPGRQE
RFNEPFVDRMDVLADRVTAALLPLADVPLTLFGHSMGASLAYEVALRLEERHRVTPAALH
VSSRKAPHRLTPLDLHRKGDDELVAVLRGLGGTDTALLDDPDIRQLVLPAVRADFTVVST
YGPRVPTAVGCPVHAWIGDTDPNVAVGDMDAWADVAPEGFRVRVLPGGHFYLLQQHETLM
RELSGHLAGDR
selected fasta
>putative type II thioesterase [thioesterase TEII family]
ATGACGACCGGCACGGACAGCACGACGTGGTTCCGCAGGTACTCCAGCACTCCCGCGCCC
CGGCGGCGGCTGGCGGTCCTGCCGCACGCGGGCGGTTCCGCGAGCTTCTTCCACGCCTGG
GGCAGCGCCTTCGGCGGCGACACCGAGGTCCTGGTGGCGCAGTACCCCGGACGCCAGGAG
CGGTTCAACGAGCCGTTCGTCGACCGGATGGACGTGCTCGCCGACCGGGTCACGGCGGCA
CTGCTGCCGCTCGCGGACGTGCCCCTGACGCTCTTCGGCCACAGCATGGGCGCGTCCCTG
GCCTACGAGGTGGCGCTGCGCCTGGAGGAGCGGCACCGCGTCACGCCCGCCGCCCTCCAC
GTCTCCAGCCGCAAGGCCCCGCACCGGCTGACCCCGCTCGACCTGCACCGGAAGGGGGAC
GACGAGCTGGTCGCCGTACTGCGCGGGCTCGGCGGGACCGATACCGCCCTGCTTGACGAC
CCGGACATCCGACAGCTCGTGCTGCCCGCGGTCCGGGCGGACTTCACCGTGGTGAGCACC
TACGGCCCCCGCGTCCCCACCGCCGTCGGCTGTCCGGTGCACGCCTGGATCGGCGACACG
GATCCGAACGTGGCGGTAGGGGACATGGACGCCTGGGCGGATGTCGCACCCGAGGGCTTC
CGGGTACGGGTCCTGCCCGGCGGCCACTTCTACCTGCTCCAGCAGCACGAGACGCTGATG
CGCGAGCTCTCGGGGCACCTGGCCGGAGACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [22-244]  1.6e-49 PF00975
PF00975   Thioesterase
SignalP
 [1-39]  0.414 Signal
Bacteria, Gram-positive   
 [1-45]  0.496 Signal
Eukaryota   
TMHMM No significant hit