close all open/close all

CDS information : Chalc_00390


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction81,439 / 80,489 / - [in whole cluster]
81,439 / 80,489 / - [in contig]
Locationcomplement(80489..81439) [in whole cluster]
complement(80489..81439) [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)ORF14
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MDHRRARAALPLSRHVRDGDAPSGTAALAGDTGRRAAPRCTDPPERAARVGQGPGDRGAR
RRVPRAADRPLAAPPARLAPGPLSAGRPQPGQHPGTGGVHARAGGRGAPVRLHAGGAGAG
AGRVEGTPAAGPHREPGVVRRPRGLAVHRGRPRDRRAGADRGPRRGAPHGADAGRGVRPD
TGLPQVAAPAARGADRAADRLVHAGPAGRAQRRRGGGHPGGAAPPGPDGERLGRLLPRPG
PAVRRQQPEAGIGRWSGRRGRRFGRHGRRHRDRRGTAELGHHRPEVGSGTVQDRDVHGPR
EDRVRDHGHRCRELPG
selected fasta
>[hypothetical protein]
ATGGACCACCGTCGAGCCCGAGCGGCTCTCCCTCTATCCCGGCACGTCCGAGACGGTGAC
GCTCCGTCTGGCACCGCCGCGCTCGCCGGAGACACGGGCCGGCGAGCTGCCCCTCGGTGT
ACGGATCCTCCCGAACGAGCAGCCCGAGTCGGTCAAGGTCCTGGAGACCGTGGTGCGCGT
CGGCGCGTTCCACGAGCTGCGGACCGACCTCTCGCCGCGCCGCCGGCGCGGCTGGCTCCG
GGGCCGCTATCTGCTGGCCGTCCGCAACCAGGGCAACACCCCGGTACGGGTGGGGTTCAC
GCCCGGGCAGGCGGGCGAGGAGCTCCGGTTCGCCTTCACGCCGGCGGAGCCGGCGCTGGA
GCCGGGCGAGTCGAAGGAACTCCGGCTGCGGGTCCGCACCGCGAGCCCGGTGTGGTTCGG
CGACCCCGTGGTCTGGCCGTTCACCGTGGACGCCCGCGAGACCGGCGAGCCGGAGCAGAC
CGAGGACCGCGCCGAGGAGCCCCACACGGCGCCGACGCTGGACGCGGAGTTCGTCCAGAT
ACCGGTCTTCCCCAAGTGGCTGCTCCTGCTGCTCGCGGCGCTGATCGCGCTGCTGATCGC
CTGGTTCACGCTGGTCCGGCCGGCCGTGCGCAGCGCCGCCGAGGAGGCGGCCACCCAGGC
GGTGCAGCCCCGCCCGGTCCCGACGGAGAGCGGCTCGGACGGCTCCTCCCCCGGCCCGGG
CCGGCCGTCCGGCGGCAGCAGCCAGAAGCCGGGATCGGGCGGTGGAGCGGGCGGCGGGGA
CGACGGTTCGGCCGGCACGGGCGACGGCACCGCGACCGGCGGGGGACGGCAGAGCTCGGC
CACCATCGACCTGAGGTCGGGAGCGGGACAGTCCAGGACCGGGACGTACACGGTCCCCGA
GAAGACCGTGTTCGGGATCACGGACATCGTTGTCGCGAACTTCCAGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-8]  0.621 Signal
Bacteria, Gram-negative   
TMHMM No significant hit