close all open/close all

CDS information : Chalc_00400


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction81,806 / 82,528 / + [in whole cluster]
81,806 / 82,528 / + [in contig]
Location81806..82528 [in whole cluster]
81806..82528 [in contig]
TypeCDS
Length723 bp (240 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative response regulator
Gene
Gene (GenBank)ORF15
EC number
Keyword
Note
Note (GenBank)
  • similar to S.coelicolor SC4261

close this sectionSequence

selected fasta
>[putative response regulator]
MFRTEEKRPVATGTTAHDAVRGHPDAHAAGFGRPRRVTVAVYAADPVLRVGVVQQLRQRP
ETELVDDADAENAQVSLVVVDALDDDVTALLTRLSYNGATRAGLVIGTLGVGALQRVVEC
GVSAVLRRAEADQDQLVQLVLAVANGEGVLPGDLLGELLGHVGSLRRAALDPGALPLSTL
TSREAEMLRLVSEGLDTAAIARKTSYSERTVKNVLHEITTRLQLRNRAHAVGYALRNGLI
selected fasta
>[putative response regulator]
ATGTTCCGCACCGAGGAGAAGAGGCCGGTCGCGACCGGCACTACGGCGCATGACGCCGTC
CGGGGCCACCCGGACGCCCATGCCGCCGGCTTCGGCCGCCCGCGCCGCGTCACCGTGGCG
GTCTACGCCGCCGACCCCGTGCTGCGGGTCGGCGTCGTCCAACAGCTCCGCCAGCGCCCC
GAGACCGAGCTCGTCGACGACGCGGACGCGGAGAACGCGCAGGTCTCCCTGGTCGTCGTC
GACGCCCTCGACGACGACGTGACCGCCCTGCTGACCCGGCTGAGCTACAACGGCGCCACC
CGCGCGGGACTCGTGATCGGCACCCTCGGCGTCGGGGCGCTCCAACGCGTCGTCGAGTGC
GGGGTGTCGGCGGTGCTGCGCCGCGCCGAGGCCGACCAGGACCAGCTCGTCCAGCTGGTC
CTGGCGGTGGCCAACGGCGAGGGCGTGCTCCCGGGCGACCTGCTCGGCGAGTTACTGGGA
CACGTCGGCAGCCTGCGCCGCGCGGCCCTCGACCCCGGCGCCCTGCCCCTCTCCACCCTC
ACCAGCAGGGAGGCGGAGATGCTGCGCCTGGTCTCGGAGGGCCTGGACACCGCGGCGATC
GCCCGCAAGACCTCGTACTCCGAGCGGACCGTGAAGAACGTCCTGCACGAGATCACCACC
CGCCTCCAACTGCGCAACCGCGCCCACGCCGTGGGCTACGCGCTCCGCAACGGGCTGATA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [173-238]  PS50043
PS50043   HTH_LUXR_2
 [180-194]  2.90000036269908e-07 PR00038 [194-210]  2.90000036269908e-07 PR00038 [210-222]  2.90000036269908e-07 PR00038
PR00038   HTHLUXR
 [178-234]  4.70000000000001e-14 PF00196
PF00196   GerE
 [177-234]  6.59999852526375e-19 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [138-240]  1.4e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [158-240]  7.69998480533694e-18 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-43]  0.068 Signal
Bacteria, Gram-negative   
 [1-43]  0.078 Signal
Bacteria, Gram-positive   
TMHMM No significant hit