close all open/close all
Chalc_00400 Chalc_00400   last last

CDS information : Chalc_00410


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction82,712 / 85,912 / + [in whole cluster]
82,712 / 85,912 / + [in contig]
Location82712..85912 [in whole cluster]
82712..85912 [in contig]
TypeCDS
Length3,201 bp (1,066 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)ORF16
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MKTAGPGGRHRRGRLASALLLLVPLLGATGVAGPDDPRTAAAAADAAETTRIAYAGTGHR
SLGEPASTDSSTPLFGAGPTHYDTDPSALGDRLVFASRRDEKHPQIYLRGADGGVLRLTS
GLDAARPRLTPDGGSVLFDAADPAGGSQRDLWLVRTDGTGLTRLTDTPASEEDPAVSPDG
ARIAYSSDADPLAGRQIYVRALTGGIPTRLTDPARGTASEPAWNPVDDDVNRAWIAYTST
TTEDGRTRQRLRITDGTTDETLFTGAYANWQGHGAAWLPDGDGIVFLSPETTCTCRTPYD
HVFRSVVHADREPSLVLDEDRDVLSPTWIGTAEGGHAIVERSSAATAHTATLQDIRADGS
DPRDLQRKILREDPQADTNTDPAKDPLFQPAPPFDPWTERQNYTPDGRRLVLTRFEGPDD
ARIERIWTADADGTNEAPMPLDGRGARDWDTDPTFSPDGTRLAFTRTSPGGVGEAAGDSR
ILLAEVATGRITGEIVPPAGELRGGDAQPTWSSDGTTLAFTRARQIAGGGGSKHVWTAST
ADLTRQRDLSATHCPRDCDVIDDSPAFSPDGRSLAFNRKNGGGRIDERNGLLLTTLSGDA
CQVLLPTAARGQDGACERELPDTTLTGPHQPRDAAWTADGKRLVFSSRAAAAVNSPEKLN
VLDVGSGDITPLTAELAGRQKEPTVQQSVDLAVEAPATTPDVTVGASGTVTVHVVNHGPA
ASPGTRLTVVPPSGVRITGIEWPGGTCDAASLQCDLGVVEAGAQVPVDVTLTGVTAGDAP
VDWSVTGAVLDPRPGDNDGRSVIPVREAPPTPTPTPTPTPTPTPTPTPTPTPTRTPTPTP
TPTRPPQPPAPKAGPGVRITVQPEPGYVGGRVVVTYSVRNGRNALATGLRLRIGLPAGVP
HGGLPAGCDRNGACALPDLTPGTTAVLRVVLSPKKAMTARVTAVLDTTGTDADRSDNTAR
ERLRVLQPRIVAVPDIGKPGFVTSVRGVDFPPGVPVRFSWNPGITAAASPTFPEADGTFI
GQLLILAKDQTGPRTITASGPGFSPVKTDFLVVSGTVQPPDGVTRR
selected fasta
>[hypothetical protein]
ATGAAGACCGCTGGCCCCGGTGGACGGCACCGCCGGGGGAGACTCGCCTCGGCGCTCCTG
CTGCTCGTCCCCCTGCTGGGCGCGACGGGCGTGGCCGGGCCGGACGACCCCCGGACCGCG
GCGGCCGCGGCGGACGCCGCCGAGACCACCCGCATCGCCTACGCGGGCACCGGCCACCGC
AGCCTCGGCGAACCGGCCTCCACCGACTCCAGCACCCCGCTGTTCGGAGCGGGACCCACC
CACTACGACACCGACCCGTCCGCCCTCGGCGACCGGCTGGTCTTCGCGAGCCGCCGCGAC
GAGAAGCACCCCCAGATCTATCTGCGGGGCGCCGACGGCGGAGTCCTGCGGCTCACCAGC
GGCCTGGACGCGGCCCGTCCCCGGCTCACCCCGGACGGCGGGTCGGTGCTCTTCGACGCC
GCCGACCCGGCCGGCGGCTCCCAGCGCGACCTGTGGCTGGTGCGCACCGACGGCACCGGG
CTGACCCGGCTGACGGACACGCCCGCCAGCGAGGAGGACCCGGCGGTCTCCCCCGACGGC
GCCCGGATCGCCTACTCCAGCGACGCCGACCCCCTGGCCGGGCGGCAGATCTACGTCCGC
GCCCTCACGGGCGGCATCCCCACCCGGCTCACCGACCCGGCCCGCGGCACGGCCTCCGAG
CCCGCCTGGAACCCCGTCGACGACGACGTCAACCGCGCGTGGATCGCGTACACGTCGACC
ACGACCGAGGACGGGCGGACCAGGCAGCGGCTGCGGATCACCGACGGCACCACCGACGAG
ACCCTGTTCACCGGCGCGTACGCGAACTGGCAGGGCCACGGGGCGGCATGGCTGCCCGAC
GGGGACGGGATCGTGTTCCTCAGCCCCGAGACCACCTGCACCTGCAGGACCCCCTACGAC
CACGTCTTCCGGTCGGTCGTGCACGCCGACCGGGAACCCTCCCTGGTGCTCGACGAGGAC
CGCGACGTCCTCTCGCCCACCTGGATCGGCACCGCCGAGGGCGGCCACGCGATCGTCGAG
CGCAGCTCGGCGGCGACCGCGCACACGGCGACCCTCCAGGACATCCGCGCGGACGGTTCC
GACCCGCGCGACCTGCAGCGGAAGATCCTGCGCGAGGACCCCCAGGCCGACACCAACACC
GACCCCGCCAAGGATCCGCTCTTCCAGCCCGCGCCCCCGTTCGACCCGTGGACCGAACGG
CAGAACTACACCCCCGACGGGCGCCGCCTCGTCCTCACCCGCTTCGAGGGCCCCGACGAC
GCGCGGATCGAGCGGATCTGGACGGCCGACGCCGACGGTACGAACGAGGCGCCGATGCCC
CTCGACGGGCGCGGCGCGCGGGACTGGGACACCGACCCGACGTTCTCCCCGGACGGCACC
CGCCTGGCCTTCACCCGCACCTCGCCCGGCGGGGTCGGCGAGGCCGCGGGAGACAGCCGC
ATCCTCCTCGCCGAGGTCGCCACCGGCCGGATCACCGGAGAGATCGTGCCCCCGGCCGGT
GAACTCCGCGGCGGGGACGCCCAGCCGACCTGGTCCTCCGACGGCACCACCCTGGCCTTC
ACCCGCGCCCGGCAGATCGCCGGGGGCGGCGGCAGCAAGCACGTGTGGACCGCGTCCACG
GCTGACCTGACCCGGCAGCGCGACCTGAGCGCGACGCACTGCCCGCGCGACTGCGACGTC
ATCGACGACAGCCCCGCCTTCTCGCCCGACGGACGCTCCCTCGCCTTCAACCGCAAGAAC
GGCGGCGGGCGGATCGACGAGCGCAACGGACTGCTCCTGACCACCCTGTCCGGCGACGCC
TGCCAGGTCCTGCTGCCCACCGCCGCCCGCGGCCAGGACGGCGCGTGCGAGCGGGAACTG
CCGGACACCACGCTCACCGGTCCGCACCAGCCGCGCGACGCCGCCTGGACCGCCGACGGC
AAGAGGCTGGTCTTCAGCTCCCGGGCCGCGGCCGCGGTCAACAGCCCGGAGAAGCTGAAC
GTCCTGGACGTCGGCTCCGGTGACATCACCCCGCTCACCGCCGAGCTCGCCGGACGCCAG
AAGGAACCCACCGTCCAGCAGTCCGTGGACCTCGCCGTCGAGGCACCCGCCACGACGCCC
GACGTCACCGTCGGCGCGTCCGGCACGGTCACCGTCCACGTGGTCAACCACGGTCCCGCC
GCCTCGCCCGGCACCCGGCTCACCGTCGTCCCGCCGTCCGGTGTGCGGATCACCGGGATC
GAGTGGCCCGGCGGCACCTGCGACGCCGCCTCCCTCCAGTGCGACCTGGGCGTCGTCGAG
GCCGGAGCCCAGGTCCCCGTGGACGTCACGCTCACCGGCGTCACCGCCGGCGACGCACCC
GTCGACTGGTCGGTCACCGGCGCCGTCCTCGACCCCCGGCCCGGCGACAACGACGGCCGG
AGCGTGATCCCCGTACGCGAGGCACCCCCGACGCCGACCCCCACGCCGACGCCGACCCCC
ACGCCCACCCCGACCCCGACTCCGACGCCGACCCCCACCCGGACCCCGACGCCCACCCCG
ACTCCGACCCGGCCCCCGCAGCCCCCCGCGCCGAAGGCCGGACCCGGGGTGCGGATCACC
GTCCAGCCCGAGCCCGGCTACGTCGGCGGACGCGTCGTCGTCACGTACAGCGTCCGCAAC
GGCCGCAACGCGCTCGCCACCGGACTCCGGCTCAGGATCGGACTGCCCGCCGGGGTGCCC
CACGGCGGACTTCCGGCGGGCTGCGACCGGAACGGCGCGTGCGCGCTGCCCGACCTCACC
CCGGGCACGACCGCCGTCCTGCGGGTCGTCCTCAGCCCGAAGAAGGCGATGACCGCCCGC
GTCACGGCCGTGCTCGACACCACCGGCACGGACGCCGACCGCAGCGACAACACCGCCCGG
GAGCGGCTGCGCGTCCTCCAGCCGCGCATCGTCGCCGTGCCCGACATCGGCAAGCCCGGA
TTCGTCACCTCCGTCCGAGGCGTGGACTTCCCGCCCGGCGTCCCGGTGCGCTTCAGCTGG
AACCCCGGGATCACCGCCGCCGCCTCGCCGACCTTCCCGGAGGCCGACGGCACGTTCATC
GGACAGCTCCTCATCCTCGCCAAGGACCAGACCGGGCCGCGCACCATCACGGCCTCGGGC
CCCGGATTCTCCCCGGTGAAGACCGACTTCCTGGTCGTCAGCGGCACCGTCCAGCCGCCG
GACGGGGTGACTCGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011042 Six-bladed beta-propeller, TolB-like (Domain)
 [397-678]  5.10000000000004e-55 G3DSA:2.120.10.30
G3DSA:2.120.10.30   6-blade_b-propeller_TolB-like
IPR011659 WD40-like Beta Propeller (Repeat)
 [161-199]  5.8e-07 PF07676 [449-469]  8.5e-05 PF07676 [506-536]  0.0012 PF07676 [561-579]  0.0023 PF07676 [634-648]  0.022 PF07676
PF07676   PD40
SignalP
 [1-32]  0.978 Signal
Bacteria, Gram-negative   
 [1-32]  0.998 Signal
Eukaryota   
 [1-42]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [13-32]  Transmembrane (i-o)
Transmembrane 1   
Chalc_00400 Chalc_00400   last last