close all open/close all
first first   Chart_00020 Chart_00020

CDS information : Chart_00010


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction1,389 / 88 / - [in whole cluster]
1,389 / 88 / - [in contig]
Locationcomplement(88..1389) [in whole cluster]
complement(88..1389) [in contig]
TypeCDS
Length1,302 bp (433 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)chaW
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAAHTDRAVKTSPSVADRWTRHRSSLLAVATIAVVAVIARFAFLDHRSEDYVDFYRRWYQ
FIEDNGGYRALRHQFSNYNVPYLYLLATTVWLKIPSLVAVKLIPIAFDVLLGWYVYRITR
LRYPTGRLPLTAALVVVLLPTVVLNSSMWGQCDSGYAALAIGGLYHLMRGRSWTACALFG
AAFAFKLQAVFLFPVLLLMVLRRKLPWQCLLAVPGMYLLLDVPALLLGAEPGKLLTVYLD
QASLLHGEFIVTAPNAFQYLDSTPQVLQTLGIVLTGVSVLGLVGAAVLRRPNLTHLQLVL
AAAVSALLVPFLLPNMHERYFYLADVLTVIAAFWLPRKLWFAPLLTQFASLFAYIPFLLL
PYRLRDLTGNPDVVGGSGFAEPAPEIRLACVGDTSRPQPAGGARQTLRTGDQLSTARHGA
ADRPHRNDRRGRR
selected fasta
>hypothetical protein [hypothetical protein]
ATGGCAGCGCACACGGACCGGGCGGTGAAGACATCGCCGTCCGTCGCGGACCGGTGGACG
CGGCACCGGTCCTCGCTCCTCGCCGTCGCCACGATCGCCGTCGTCGCCGTGATCGCCCGG
TTCGCCTTCCTGGACCACAGGTCCGAGGACTACGTCGACTTCTACCGCCGCTGGTACCAG
TTCATCGAGGACAACGGGGGCTACCGCGCGCTGCGGCACCAGTTCTCCAACTACAACGTG
CCCTACCTTTATCTGCTCGCGACGACCGTATGGCTGAAGATCCCCTCGCTGGTCGCGGTG
AAGCTGATCCCGATCGCGTTCGACGTGCTGCTCGGCTGGTACGTGTACCGGATCACCAGG
CTCCGGTATCCGACCGGCCGGCTCCCGCTCACGGCGGCGCTCGTGGTCGTGCTGCTTCCG
ACGGTCGTGCTGAACAGCTCCATGTGGGGTCAGTGCGACTCCGGTTATGCCGCCCTGGCG
ATCGGCGGGCTGTACCACCTCATGCGGGGCAGGTCGTGGACGGCGTGCGCCCTGTTCGGC
GCGGCGTTCGCCTTCAAGCTCCAGGCCGTCTTCCTGTTCCCGGTCCTGCTGCTGATGGTG
CTGCGCCGCAAGCTGCCCTGGCAGTGCCTGCTCGCTGTTCCCGGCATGTATCTGCTGCTC
GACGTCCCGGCGCTGCTGCTGGGCGCCGAGCCGGGGAAACTGCTCACCGTCTACCTCGAC
CAGGCGTCGCTGCTGCACGGCGAGTTCATCGTGACCGCCCCCAACGCCTTCCAGTACCTG
GACTCCACGCCACAGGTCCTTCAGACGCTGGGGATCGTGCTGACCGGGGTGTCGGTGCTC
GGACTGGTCGGCGCGGCGGTGCTGCGCCGTCCCAACCTGACGCACCTCCAGCTGGTGCTG
GCGGCTGCGGTCTCGGCGCTGCTGGTGCCGTTCCTGCTGCCCAACATGCACGAGCGGTAC
TTCTACCTCGCCGACGTGCTCACGGTGATCGCCGCGTTCTGGCTCCCCCGCAAGCTCTGG
TTCGCGCCGCTCCTCACACAGTTCGCCTCCCTGTTCGCCTACATCCCGTTCCTGCTGCTG
CCGTACCGGCTGCGCGACCTCACCGGGAATCCGGACGTCGTTGGCGGATCCGGCTTCGCC
GAGCCGGCACCGGAGATCCGGCTGGCTTGCGTCGGCGATACGTCTCGGCCCCAGCCCGCG
GGAGGTGCTCGCCAAACTCTTCGAACCGGTGATCAGCTATCAACTGCTCGCCACGGCGCT
GCTGATCGCCCTCATCGGAACGATCGCCGTGGCCGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-39]  0.378 Signal
Bacteria, Gram-positive   
TMHMM
 [25-44]  Transmembrane (i-o) [94-116]  Transmembrane (o-i) [128-150]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [207-229]  Transmembrane (i-o) [266-288]  Transmembrane (o-i) [295-314]  Transmembrane (i-o) [339-361]  Transmembrane (o-i)
Transmembrane 8   
first first   Chart_00020 Chart_00020