close all open/close all

CDS information : Chart_00020


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction2,233 / 1,460 / - [in whole cluster]
2,233 / 1,460 / - [in contig]
Locationcomplement(1460..2233) [in whole cluster]
complement(1460..2233) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChaM protein
Gene
Gene (GenBank)chaM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [ChaM protein]
MDTSMYHAFAAVESRHWWFQGRRRIVAALLRDQLRDVRRAKPGGLDILDVGSGTGEMVEM
LREFGTVTALDSSPHAIDYLRQRLPEGVSARHGSIPEDLPRDEMFDLVTAFDVVEHLNDD
LAALRAFRQVLPTGGRMALTVPAYQMLWSHHDVYAGHVRRYRRAQLRDLVQRAGGFQVER
LAYFNSLLFLPALAARSAGRWRRRVSPRVAERVDPHLALPSPLVNRLLLGVFSSEAGLLS
RVDPPFGVSLVALCRAC
selected fasta
>hypothetical protein [ChaM protein]
ATGGACACCTCCATGTACCACGCGTTCGCCGCGGTGGAGAGCCGGCACTGGTGGTTCCAG
GGGCGTCGGCGGATCGTCGCCGCGCTGCTGCGGGACCAGCTGAGGGATGTCCGGCGAGCG
AAGCCCGGTGGGCTGGACATCCTCGACGTCGGGTCGGGGACGGGCGAAATGGTCGAGATG
CTGCGCGAGTTCGGGACCGTCACCGCACTCGACAGTTCCCCGCACGCCATCGACTACCTG
CGGCAGAGACTGCCCGAGGGTGTGTCGGCCCGGCACGGCAGCATCCCCGAGGATCTGCCC
CGCGACGAGATGTTCGACCTGGTGACCGCCTTCGACGTGGTCGAGCACCTCAACGACGAC
CTGGCGGCGCTGCGCGCGTTCCGCCAAGTACTGCCCACGGGCGGCCGCATGGCGCTCACC
GTCCCCGCCTACCAGATGCTGTGGAGCCACCACGACGTCTACGCCGGGCACGTCAGGCGC
TACCGCCGTGCGCAGCTGCGGGATCTCGTGCAGCGGGCCGGCGGCTTCCAGGTGGAACGC
CTCGCCTACTTCAACTCGCTGCTGTTCCTGCCGGCCCTCGCGGCGAGGTCGGCGGGCCGC
TGGCGGCGCCGGGTGTCGCCACGCGTGGCCGAGCGCGTCGATCCGCATCTGGCCCTGCCT
TCCCCGCTGGTGAACCGGCTTCTGCTCGGGGTCTTCTCCTCCGAGGCCGGTCTGCTGTCA
CGCGTCGACCCGCCGTTCGGCGTCTCGCTCGTCGCGCTGTGCCGCGCCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-27]  0.264 Signal
Bacteria, Gram-positive   
TMHMM No significant hit