close all open/close all

CDS information : Chart_00030


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction3,360 / 2,239 / - [in whole cluster]
3,360 / 2,239 / - [in contig]
Locationcomplement(2239..3360) [in whole cluster]
complement(2239..3360) [in contig]
TypeCDS
Length1,122 bp (373 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)ChaGT2 protein
Gene
Gene (GenBank)chaGT2
EC number
Keyword
  • D-digitalose
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9T1D6
PmId
[10376843] Functional analysis of the O antigen glucosylation gene cluster of Shigella flexneri bacteriophage SfX. (Microbiology. , 1999)

close this sectionSequence

selected fasta
>putative glycosyltransferase [ChaGT2 protein]
MRTDAETPQAHDTPDLYRALALGDYVLGRTPLHIAARTAGFSADEMLRLVRSRVDVPADP
APGPPGPREPLLSVVVPVFNNATTLRELHRRLRGALTPIGTFEILFVDDGSIDGSADLIG
ELHREDPSVRLLRLSRNFGQQAALSAGLDVARGAAVVMLDADLQDPPELIGDLVERWRAG
HEVVYMVRRNRKEGPLKRLAYAVFYRVFRYLADIEVPLSSGDFALLDRRVVAVLRSMPER
SRFLRGLRSWSGFRQAAVEYDRARRPSGESQYTLRRLAKLAADGLLGFSSVPLRLVSTLG
LATAAAGAVMVVLVLLARLSALSLPVGWASTISVVLLVGGAQLTTIGMVGAYIARIYHEV
KKRPLYIVMERLG
selected fasta
>putative glycosyltransferase [ChaGT2 protein]
ATGCGCACCGACGCCGAAACGCCCCAGGCACACGACACGCCCGACCTGTATCGCGCGCTC
GCCCTGGGTGACTACGTGCTGGGCCGGACGCCCCTGCACATCGCCGCCCGGACCGCCGGA
TTCTCCGCCGACGAGATGCTGCGCCTGGTGCGCTCACGCGTCGACGTTCCGGCCGACCCG
GCACCAGGCCCTCCCGGACCCCGGGAGCCGCTGCTGTCGGTGGTCGTCCCGGTCTTCAAC
AACGCCACCACCCTGCGTGAACTGCACCGCCGTCTGCGCGGGGCGCTCACCCCGATCGGC
ACCTTCGAGATCCTGTTCGTCGACGACGGCAGCATCGACGGCTCGGCCGACCTCATCGGC
GAACTGCACCGCGAGGACCCGTCGGTCCGGCTGCTCCGGCTGTCGCGCAACTTCGGCCAG
CAGGCGGCCCTGAGCGCCGGGCTGGACGTCGCCCGGGGCGCGGCGGTCGTCATGCTGGAC
GCCGACCTCCAGGACCCGCCCGAGCTGATCGGCGACCTCGTCGAGCGCTGGCGGGCGGGC
CACGAGGTCGTCTACATGGTCCGCAGGAACCGCAAGGAAGGGCCGCTCAAGCGCCTGGCC
TACGCGGTCTTCTACCGGGTCTTCCGATACCTCGCGGACATCGAAGTGCCCCTGTCCAGC
GGGGACTTCGCGCTCCTGGACCGCCGTGTGGTGGCCGTGCTGCGCTCGATGCCGGAGCGC
AGCAGGTTCCTGCGCGGGTTGCGCAGCTGGTCGGGGTTCCGGCAGGCCGCCGTCGAGTAC
GACCGCGCCCGCCGGCCGTCCGGCGAGTCCCAGTACACCCTGCGCCGGCTGGCCAAGCTC
GCCGCGGACGGACTGCTCGGCTTCTCCAGCGTTCCGCTGCGGCTGGTGTCCACGCTCGGC
CTCGCGACCGCCGCCGCCGGAGCCGTGATGGTGGTCCTGGTGCTGCTGGCCCGGCTCAGC
GCCTTGTCGCTGCCGGTGGGCTGGGCCTCCACGATCTCCGTGGTCCTCCTCGTCGGCGGA
GCCCAGCTCACCACCATCGGCATGGTCGGCGCCTACATCGCGCGGATCTACCACGAGGTC
AAGAAACGTCCTCTGTACATCGTCATGGAACGGCTGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001173 Glycosyl transferase, family 2 (Domain)
 [73-231]  1.3e-26 PF00535
PF00535   Glycos_transf_2
SignalP
 [1-37]  0.048 Signal
Eukaryota   
TMHMM
 [295-317]  Transmembrane (i-o) [332-354]  Transmembrane (o-i)
Transmembrane 2