close all open/close all

CDS information : Chart_00040


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction4,169 / 3,402 / - [in whole cluster]
4,169 / 3,402 / - [in contig]
Locationcomplement(3402..4169) [in whole cluster]
complement(3402..4169) [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)ChaG protein
Gene
Gene (GenBank)chaG
EC number
Keyword
  • 2nd and 3rd ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase [ChaG protein]
MRLIDLSSPIDATSWEPDPIEHSIMTPAQGARHLVAEMEQHFGLSLDPDDLPDGEFLNND
TLTLTTHVGTHVDAPTHYGSTAAYGKPKTIDQVPLEWFYRPGVVLDLTAAGVGSVDARFI
AAELDRVGHEVRPYDIVLLRTGAEEWSGTQRYFTDFTGLDGSAVHYLLDLGVRVIGTDAF
SLDAPFTHIMERYADTGDRALLWPAHFAGREREYCQIERLANLGALPSSGFSVVCFPVRV
ARAGAGWARAVAVLD
selected fasta
>putative cyclase [ChaG protein]
ATGCGCCTGATCGACCTGTCCTCCCCGATCGACGCCACGTCATGGGAGCCGGACCCGATC
GAGCACTCGATCATGACCCCGGCGCAGGGGGCCCGGCACCTGGTCGCGGAGATGGAGCAG
CACTTCGGCCTGTCCCTGGACCCCGACGACCTGCCGGACGGCGAGTTCCTCAACAACGAC
ACGCTGACCCTGACGACCCACGTCGGCACCCATGTCGACGCCCCGACCCACTACGGCTCC
ACGGCGGCGTACGGGAAGCCGAAGACCATCGACCAGGTACCGCTGGAGTGGTTCTACCGT
CCGGGCGTGGTGCTGGACCTCACGGCGGCCGGCGTGGGGAGCGTCGACGCCCGCTTCATC
GCCGCCGAGCTCGACCGCGTCGGGCACGAGGTGCGGCCGTACGACATCGTGCTGCTGCGC
ACGGGGGCCGAGGAGTGGAGCGGTACGCAGCGCTACTTCACGGACTTCACCGGGCTGGAC
GGGTCGGCCGTGCACTACCTCCTCGACCTGGGGGTCCGGGTCATCGGCACGGACGCGTTC
AGCCTCGACGCCCCGTTCACCCACATCATGGAGCGCTACGCCGACACCGGGGACCGGGCT
CTGCTGTGGCCGGCGCACTTCGCGGGCCGGGAGCGGGAGTACTGCCAGATCGAGCGACTG
GCCAATCTCGGTGCCCTGCCCTCCTCCGGTTTCTCGGTCGTCTGCTTCCCGGTGCGGGTC
GCCCGTGCCGGAGCGGGCTGGGCACGCGCTGTCGCGGTCCTCGATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [4-185]  1.6e-40 PF04199
PF04199   Cyclase
SignalP
 [1-36]  0.066 Signal
Bacteria, Gram-positive   
TMHMM No significant hit