close all open/close all

CDS information : Chart_00050


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction5,128 / 4,160 / - [in whole cluster]
5,128 / 4,160 / - [in contig]
Locationcomplement(4160..5128) [in whole cluster]
complement(4160..5128) [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)ChaF protein
Gene
Gene (GenBank)chaF
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [ChaF protein]
MTAPTMRSTEHSITVAAPARRVYDIVARAADWPHHFTPTLHVEVLESGGDEERLRIWAIA
NGEVKCWTSHRVLDPTALSVRFRQEVPAPPVAFMSGEWRMTPLDAHTTRVTFLHEYGAVD
DDPQSLRWIDRAVDSNSAEELARLGNAAELAGRIDELLLSFEDSVEIAAPAGDVHDFLRD
AGEWPRRIPHVDRVELTEDAGVQHMDMDTRTADGSVHTTSSVRICLPPDRIVYKQVVTPL
LMTAHTGSWHITARPEGTLATSRHTVLLAPDRVREVLGPDATLATARDFVRRALGHNSTV
TLKHAKAYAEALEAGTEEGSCA
selected fasta
>putative cyclase/dehydratase [ChaF protein]
ATGACGGCACCGACCATGCGTTCCACCGAGCACTCGATCACCGTGGCGGCTCCGGCCCGG
CGCGTGTACGACATCGTGGCCCGCGCCGCCGACTGGCCGCACCACTTCACGCCCACCCTG
CACGTCGAGGTCCTGGAGTCCGGCGGCGACGAGGAACGCCTGCGCATCTGGGCCATCGCC
AATGGCGAGGTGAAGTGCTGGACGTCCCACCGCGTCCTGGACCCGACGGCGCTGAGCGTC
CGCTTCCGCCAGGAGGTCCCCGCTCCCCCGGTGGCCTTCATGAGCGGCGAATGGCGCATG
ACGCCCCTCGACGCCCACACCACCCGCGTGACGTTCCTGCACGAGTACGGTGCCGTCGAC
GACGATCCGCAGTCGCTGCGGTGGATCGACAGGGCCGTCGACAGCAACAGCGCCGAGGAG
CTGGCCCGGCTCGGGAACGCCGCCGAACTGGCCGGCCGTATCGACGAACTCCTGCTCTCC
TTCGAGGACTCGGTCGAGATCGCGGCGCCCGCAGGGGACGTCCACGACTTCCTCCGCGAC
GCGGGCGAGTGGCCGCGGCGCATCCCGCACGTGGACCGGGTGGAGCTGACCGAGGACGCC
GGCGTGCAGCACATGGACATGGACACCCGTACCGCCGACGGCTCGGTGCACACGACGTCC
TCGGTGCGGATCTGCCTTCCCCCCGACCGGATCGTCTACAAACAGGTCGTCACCCCGCTG
CTGATGACCGCCCACACCGGTTCCTGGCACATCACGGCACGCCCGGAGGGCACGCTGGCC
ACGTCCCGCCACACTGTCCTGCTCGCCCCGGACCGGGTGCGCGAGGTGCTGGGCCCGGAC
GCCACCCTCGCCACCGCGCGGGACTTCGTCCGCCGGGCCCTCGGCCACAACAGCACCGTC
ACGCTGAAGCACGCCAAGGCGTACGCCGAGGCTCTCGAAGCCGGCACCGAGGAGGGCTCA
TGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [6-149]  3.7e-11 PF10604 [160-310]  5.5e-11 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [6-116]  1.6e-14 G3DSA:3.30.530.20 [160-261]  5.8e-11 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-29]  0.167 Signal
Bacteria, Gram-negative   
TMHMM No significant hit