close all open/close all

CDS information : Chart_00060


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction5,933 / 5,148 / - [in whole cluster]
5,933 / 5,148 / - [in contig]
Locationcomplement(5148..5933) [in whole cluster]
complement(5148..5933) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)ChaD protein
Gene
Gene (GenBank)chaD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q8VWB5
PmId
[8157619] Nucleotide sequence of the aknA region of the aklavinone biosynthetic gene cluster of Streptomyces galilaeus. (J Bacteriol. , 1994)
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [ChaD protein]
MTEDASRTALITGATSGIGLSAARALAARGMRVFICSRNADDVARTVKELRNLGARADGA
QADVRDREDVEALVSRAVAAFGGVDVLVNNAGRSGGGVTARITDELWSDVIATNLTSVFR
LTREVLVNAGMLERGWGRVINIASTGGKQGVVLGAPYSASKHGVVGFTKALGLELAKTGV
TVNAVCPGYVETPMAERVRQGYAAAWETTEAEVLERFESRIPLGRYTTPDEVAGIVGYLV
TDSAAPITAQAINVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [ChaD protein]
ATGACCGAGGACGCCTCGCGTACCGCGCTGATAACCGGCGCCACCAGTGGAATAGGGCTT
TCGGCCGCGCGCGCACTTGCGGCACGCGGGATGCGAGTCTTCATCTGCTCCCGGAATGCC
GACGACGTCGCGCGAACGGTGAAGGAACTGCGCAACCTCGGGGCCCGGGCCGACGGGGCC
CAGGCCGACGTACGTGACCGCGAGGACGTCGAGGCCCTGGTGAGCAGGGCGGTCGCAGCC
TTCGGCGGGGTCGACGTGCTGGTCAACAATGCCGGCCGCAGCGGCGGCGGGGTCACGGCC
CGGATCACCGACGAGCTGTGGTCCGACGTGATCGCGACGAACCTCACCAGCGTTTTCCGG
CTGACCCGTGAGGTTCTGGTCAACGCCGGAATGCTGGAACGGGGGTGGGGCCGCGTCATC
AACATCGCGTCCACCGGCGGAAAGCAGGGCGTGGTGCTGGGCGCCCCCTATTCGGCCTCG
AAACACGGCGTCGTGGGATTCACCAAGGCCCTGGGACTGGAACTCGCCAAGACCGGCGTG
ACGGTGAACGCGGTGTGCCCCGGATATGTCGAGACGCCGATGGCCGAACGCGTACGGCAG
GGATACGCGGCGGCGTGGGAGACGACCGAGGCCGAAGTCCTCGAACGATTCGAGAGCCGT
ATTCCCCTGGGCCGTTACACGACCCCGGACGAGGTCGCCGGAATCGTCGGATATCTGGTG
ACCGATTCCGCCGCGCCCATCACGGCGCAGGCCATCAACGTCTGCGGCGGGCTCGGCAAC
TACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  1.80000149287196e-14 PR00080 [137-145]  1.80000149287196e-14 PR00080 [157-176]  1.80000149287196e-14 PR00080
PR00080   SDRFAMILY
 [5-248]  2.00000075217456e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
 [8-175]  6.49999999999992e-38 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1.49999648196323e-46 PR00081 [82-93]  1.49999648196323e-46 PR00081 [131-147]  1.49999648196323e-46 PR00081 [157-176]  1.49999648196323e-46 PR00081 [178-195]  1.49999648196323e-46 PR00081 [222-242]  1.49999648196323e-46 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-258]  3.49999999999995e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-27]  0.88 Signal
Bacteria, Gram-negative   
 [1-27]  0.695 Signal
Eukaryota   
 [1-27]  0.611 Signal
Bacteria, Gram-positive   
TMHMM No significant hit