close all open/close all

CDS information : Chart_00080


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction6,565 / 7,056 / + [in whole cluster]
6,565 / 7,056 / + [in contig]
Location6565..7056 [in whole cluster]
6565..7056 [in contig]
TypeCDS
Length492 bp (163 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChaS3 protein
Gene
Gene (GenBank)chaS3
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [ChaS3 protein]
MTSPPDGGAEQGAPAGRRHAPLLGELARFGVMGVVNSTVAIAGTSVLHVGLRVGPLTSNA
IATLLATTLSFAGNRWWTFRHRRRSNLVQEYALFFVLNGAGLLIQLLAIAFAVRVLDRDD
PVSYHVALLVGVAVASLVRFLSYKKWVFLPRERPVRAGARRPG
selected fasta
>hypothetical protein [ChaS3 protein]
ATGACATCGCCTCCTGACGGCGGCGCCGAACAGGGCGCGCCGGCAGGCCGACGGCACGCG
CCGCTCCTCGGTGAACTCGCCCGCTTCGGAGTGATGGGAGTCGTCAACTCCACGGTGGCG
ATAGCCGGCACCAGCGTGCTCCATGTCGGCCTGCGGGTGGGGCCGCTCACCTCGAACGCG
ATCGCCACCCTGCTCGCGACGACCCTGTCGTTCGCCGGGAACCGCTGGTGGACCTTCCGG
CACCGCAGACGCAGCAACCTCGTCCAGGAGTACGCCCTCTTCTTCGTCCTGAACGGCGCC
GGCCTGCTGATCCAGCTCCTCGCCATCGCGTTCGCCGTCCGGGTACTGGACCGGGACGAC
CCGGTGTCGTACCACGTGGCGCTGCTCGTCGGGGTGGCCGTGGCCTCGCTGGTCCGCTTC
CTCAGCTACAAGAAGTGGGTGTTCCTCCCGAGGGAGCGGCCGGTCCGTGCGGGTGCGCGC
AGGCCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007267 GtrA-like protein (Domain)
 [28-148]  1.4e-22 PF04138
PF04138   GtrA
SignalP No significant hit
TMHMM
 [51-73]  Transmembrane (o-i) [94-116]  Transmembrane (i-o) [121-143]  Transmembrane (o-i)
Transmembrane 3