close all open/close all

CDS information : Chart_00090


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction7,915 / 7,130 / - [in whole cluster]
7,915 / 7,130 / - [in contig]
Locationcomplement(7130..7915) [in whole cluster]
complement(7130..7915) [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)ChaR1 protein
Gene
Gene (GenBank)chaR1
EC number
Keyword
  • SARP family
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9XCC4
PmId
[11985721] Differential roles of two SARP-encoding regulatory genes during tylosin biosynthesis. (Mol Microbiol. , 2002)
[16942604] Regulation of tylosin biosynthesis involving 'SARP-helper' activity. (Mol Microbiol. , 2006)
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [ChaR1 protein]
MEIRILGPISIEPIGTVSTRLAPKPRKILALLLLNANKIVSTASLMTELWGETPPKSATT
TLQTYVLHLRKALGALWEIDLPDIAKNVLTTHTNGYMLSISPGTVDLHVYNKLVADGRRA
LEEGQIERGAARFDEALALWSGPPLADVPIGPLLEAEVMRLEEDRLGILEDRISADLRLG
RHHQLLGELTSLVAQHPFHEGLHEKLMVALHRSGRRHQALDVYQRLRSSLVDELGIDPSP
RLQRLHQSVLASDPRLDNAAA
selected fasta
>putative transcriptional regulator [ChaR1 protein]
TTGGAGATACGAATACTCGGCCCCATATCCATCGAACCGATCGGGACGGTGAGCACTCGA
CTCGCCCCCAAGCCACGCAAGATCCTGGCTCTGCTGCTCCTCAACGCGAACAAGATCGTA
TCGACTGCTTCACTCATGACCGAGCTCTGGGGCGAGACCCCGCCCAAGAGCGCGACCACG
ACCTTGCAGACCTATGTCCTGCACCTGCGCAAGGCACTTGGCGCCCTATGGGAAATCGAT
CTGCCTGACATAGCCAAGAACGTGCTCACCACACACACCAACGGCTACATGCTCAGCATC
TCGCCCGGGACGGTCGACCTGCATGTGTACAACAAGCTCGTGGCCGATGGCCGGCGTGCC
CTGGAAGAAGGGCAGATCGAACGCGGGGCCGCCCGTTTCGACGAGGCGCTGGCACTGTGG
AGCGGTCCCCCGCTCGCCGACGTGCCCATCGGTCCGCTGCTGGAGGCGGAGGTGATGCGT
CTGGAGGAGGACCGGCTCGGCATCCTGGAGGACCGGATCAGCGCGGACCTCCGGCTTGGC
CGGCACCATCAACTGCTGGGCGAACTGACCTCGTTGGTCGCACAGCATCCCTTCCACGAG
GGTCTGCACGAGAAGCTGATGGTGGCGCTGCACCGGTCCGGCCGGCGGCACCAGGCCCTG
GACGTCTATCAGCGTCTGCGCTCGTCGCTCGTGGACGAGCTCGGCATCGATCCGTCGCCC
AGGCTCCAGCGTCTGCACCAGTCCGTCCTCGCCTCCGACCCGAGGCTGGACAACGCGGCG
GCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-98]  1.5e-09 SM00862
SM00862   Transcriptional regulatory protein, C ter
 [19-98]  1.9e-19 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [105-250]  1.8e-55 PF03704
PF03704   BTAD
 [105-250]  8.7e-60 SM01043
SM01043   Bacterial transcriptional activator domai
IPR011990 Tetratricopeptide-like helical (Domain)
 [112-226]  0.00069 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [18-100]  2.8e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-99]  1.2e-14 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit