close all open/close all

CDS information : Chart_00100


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction8,278 / 9,546 / + [in whole cluster]
8,278 / 9,546 / + [in contig]
Location8278..9546 [in whole cluster]
8278..9546 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ChaA protein
Gene
Gene (GenBank)chaA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS5..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ChaA protein]
MDYCVAITGIGVRAPGGIGTNAFWELLTSGRTATRTISFFDPSPFRSRVAAECDFDARAE
GFTPKELRRMDRAAQLGVAAAREALADSGLGGGGLDPADVSVTVGSAVGCTMGLEQEYST
VSDGGRQWLVDHTYAVPHLYGHFVPSSLAAEVAWAVAAEGPVSVVSTGCTSGLDAIGHAC
GLLREGAGKVAVAGATDAPISPITVACFDAIKATTARNDDPEHASRPFDRSRDGFVLGEG
SAFFVLEPLEDARRRGAHVYATIRGFASRSNAYHMTGLRPDGREMAEAITAALGQARLRP
DDIDYVNAHGSGTRQNDRHETAAVKRSLGAHAFDVPVSSIKSMIGHSLGAIGAIEIAACA
LAIEHDVIPPTANLEEPDPDCDLDYVPKTAREQRTDAVLTVGSGFGGFQSAMVLAAPGAA
AR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ChaA protein]
ATGGACTACTGTGTGGCGATAACCGGAATCGGAGTCCGGGCGCCAGGGGGAATCGGCACC
AATGCGTTCTGGGAACTCCTGACGTCCGGTCGTACCGCAACACGCACGATATCTTTCTTC
GACCCCTCCCCGTTCCGGTCCCGCGTCGCGGCCGAGTGCGATTTCGACGCGCGCGCCGAG
GGCTTCACGCCCAAGGAACTGAGGAGGATGGACCGCGCCGCGCAACTGGGCGTCGCGGCC
GCCCGCGAGGCCCTCGCCGACAGCGGCCTGGGTGGCGGCGGGCTGGATCCGGCGGACGTG
TCCGTCACGGTGGGCAGCGCCGTCGGTTGCACCATGGGCCTGGAACAGGAGTACTCGACC
GTCAGCGACGGCGGCCGGCAGTGGCTCGTCGACCACACCTACGCCGTGCCGCACCTGTAC
GGCCACTTCGTCCCGAGCTCGCTGGCCGCCGAAGTGGCCTGGGCCGTGGCGGCCGAGGGA
CCCGTGTCGGTCGTCTCGACGGGATGCACCTCCGGGCTCGACGCGATCGGCCATGCGTGC
GGGCTGCTGCGGGAGGGAGCCGGGAAGGTCGCGGTGGCCGGTGCCACCGACGCGCCGATC
TCCCCGATCACCGTCGCCTGCTTCGACGCCATCAAGGCCACCACGGCACGCAACGACGAC
CCGGAGCACGCATCCCGGCCCTTCGACCGCAGCCGGGACGGCTTCGTGCTGGGCGAGGGG
AGCGCGTTCTTCGTCCTGGAGCCGCTGGAGGACGCTCGGCGCCGAGGGGCCCATGTGTAC
GCCACGATCCGGGGGTTCGCGTCCCGGTCGAACGCCTATCACATGACCGGTCTGCGGCCG
GACGGCCGGGAGATGGCGGAGGCGATCACCGCGGCACTCGGACAGGCGCGGTTGCGGCCC
GACGACATCGACTACGTCAACGCGCACGGCTCCGGCACCAGGCAGAACGACCGGCACGAG
ACGGCGGCGGTCAAGCGCAGCCTCGGCGCGCACGCCTTCGACGTCCCGGTCAGTTCCATC
AAGTCGATGATCGGGCATTCGCTGGGTGCCATCGGGGCCATCGAGATCGCGGCGTGTGCG
CTGGCCATCGAGCACGACGTCATCCCACCCACAGCCAACCTGGAGGAACCCGACCCCGAC
TGCGACCTCGACTACGTTCCCAAGACCGCGCGCGAGCAGCGGACCGACGCCGTGCTGACG
GTGGGCAGCGGCTTCGGCGGATTCCAGAGCGCGATGGTGCTCGCCGCTCCGGGAGCGGCC
GCCCGATGA
KS5..375
KS13..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-252]  5.19999999999996e-60 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  3.40000000000004e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-265]  1.29999999999998e-64 G3DSA:3.40.47.10 [270-416]  2.29999999999998e-55 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-419]  6.69996745106047e-70 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit