close all open/close all

CDS information : Chart_00110


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction9,543 / 10,769 / + [in whole cluster]
9,543 / 10,769 / + [in contig]
Location9543..10769 [in whole cluster]
9543..10769 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)ChaB protein
Gene
Gene (GenBank)chaB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q56164
NITE
Jado_00090
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionPKS/NRPS Module

CLF4..362

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [ChaB protein]
MSAKVVVTGLGVAAPNGLGTRAYWEATLRGRSGIAPLKRFDARGYPARLAGEVPGFEPAE
HLPGRLLPQTDHMTRMALVAADWALADARADPERLAEFSMGVVTASSSGGFEFGQRELEK
LWSKGSRYVSSYQSFAWFYAVNTGQISIRNGMRGPSGVLVSDQAGGLDAVAQARRLVREG
LALVVSGGVDASLCPWGWVAQLSTGRLSTGDDPRSAYLPFSAAARGYVPGEGGAILVLEE
EGAAARRRPGAPYGEIAGYGATFDPHPDSGRPPRLRDAIEIALGDAGLDPSDVDVLFADA
AGLPDLDRVEAEAISDVFGPRGVPVTAPKTMTGRLYSGGAALDLAAALLSLNEGVVPPTV
NVGRPAPEYAIDLVVRPRPAPLRVALVLARGHGGFNAAMVVRAPHARD
selected fasta
>polyketide synthase chain length factor subunit [ChaB protein]
ATGAGTGCCAAGGTCGTGGTCACCGGGCTCGGTGTCGCCGCACCCAACGGGCTCGGCACA
CGCGCCTATTGGGAGGCGACGCTGCGCGGCCGCAGCGGGATCGCCCCGCTGAAGCGGTTC
GACGCACGGGGCTACCCCGCCCGGCTCGCCGGCGAGGTACCCGGCTTTGAACCGGCCGAG
CATCTGCCGGGCCGGTTGCTGCCGCAGACGGACCACATGACCAGGATGGCGCTGGTGGCG
GCCGACTGGGCCCTGGCGGACGCGCGGGCCGATCCGGAGCGGCTCGCGGAGTTCTCGATG
GGAGTGGTGACGGCCAGTTCCTCCGGAGGCTTCGAGTTCGGGCAGCGGGAGCTGGAGAAG
CTGTGGAGCAAGGGCAGCCGGTACGTCAGCTCGTACCAGTCCTTCGCGTGGTTCTACGCC
GTCAACACCGGCCAGATCTCCATCCGGAACGGCATGCGCGGCCCGAGCGGCGTCCTGGTG
AGCGACCAGGCGGGCGGGCTGGACGCCGTGGCGCAGGCCCGCCGGCTGGTGCGCGAAGGG
CTCGCACTGGTCGTATCCGGTGGCGTGGACGCAAGCCTGTGTCCCTGGGGCTGGGTCGCT
CAGCTCAGCACCGGCCGGCTCAGCACCGGCGACGACCCACGGTCCGCGTATCTGCCGTTC
AGCGCCGCGGCGCGCGGCTACGTGCCCGGCGAGGGCGGCGCGATCCTCGTGCTGGAGGAG
GAGGGTGCCGCCGCTCGGCGCCGCCCGGGTGCGCCGTACGGCGAGATCGCGGGCTACGGC
GCGACGTTCGACCCGCATCCGGACAGCGGGCGGCCGCCGCGGCTCCGCGACGCCATCGAG
ATCGCGCTCGGCGACGCCGGGCTCGACCCGTCCGACGTGGACGTCCTCTTCGCCGACGCC
GCTGGACTGCCGGACCTGGACCGGGTGGAGGCCGAGGCGATCAGCGACGTCTTCGGGCCG
CGTGGCGTCCCGGTCACCGCCCCCAAGACGATGACCGGACGGCTCTACTCGGGCGGCGCC
GCCCTGGACCTGGCCGCAGCCCTGCTCTCGCTCAACGAGGGTGTCGTCCCGCCGACCGTC
AACGTGGGGCGGCCGGCCCCCGAGTACGCGATCGACCTGGTCGTGCGGCCGAGGCCCGCC
CCCTTGCGTGTCGCGCTGGTGCTCGCACGCGGGCACGGCGGCTTCAACGCCGCGATGGTC
GTCCGCGCTCCCCACGCCCGCGACTGA
CLF4..362
CLF10..1086

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-241]  3.2e-57 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-362]  7.79999999999999e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-258]  6.29999999999998e-52 G3DSA:3.40.47.10 [271-403]  5.10000000000004e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-249]  3.39999972437719e-59 SSF53901 [212-404]  5.79999653854781e-47 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-19]  0.726 Signal
Eukaryota   
TMHMM No significant hit