close all open/close all

CDS information : Chart_00120


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction10,835 / 11,092 / + [in whole cluster]
10,835 / 11,092 / + [in contig]
Location10835..11092 [in whole cluster]
10835..11092 [in contig]
TypeCDS
Length258 bp (85 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)ChaC protein
Gene
Gene (GenBank)chaC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q02054
NITE
Actino_00200
PmId
[16285746] Self-malonylation is an intrinsic property of a chemically synthesized type II polyketide synthase acyl carrier protein. (Biochemistry. , 2005)
[19361520] Probing the Interactions of early polyketide intermediates with the Actinorhodin ACP from S. coelicolor A3(2). (J Mol Biol. , 2009)
[19381365] Preliminary kinetic analysis of acyl carrier protein-ketoacylsynthase interactions in the actinorhodin minimal polyketide synthase. (Mol Biosyst. , 2009)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [ChaC protein]
MSELTLEQLRTIMTECAGAADGVAPDDDIRDIEFGLLGYDSIALLETAARLERDYGISFE
DEAVGQVRTPQALLDLVNNALADAA
selected fasta
>polyketide synthase acyl carrier protein subunit [ChaC protein]
ATGAGTGAACTGACCCTGGAACAACTCCGGACGATCATGACGGAGTGCGCGGGCGCGGCG
GACGGCGTCGCACCTGACGACGACATCCGCGACATCGAGTTCGGGCTCCTCGGATACGAC
TCGATCGCGCTGCTGGAGACCGCGGCCCGGCTGGAACGCGACTACGGCATCAGCTTCGAG
GACGAGGCCGTCGGGCAGGTCCGGACCCCCCAGGCCCTGCTGGACCTGGTCAACAACGCC
CTCGCCGACGCCGCCTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [3-83]  2.80000000000001e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [8-77]  1.5e-07 PF00550
PF00550   PP-binding
 [1-84]  1.49999977583352e-13 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit