close all open/close all

CDS information : Chart_00130


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction11,162 / 12,310 / + [in whole cluster]
11,162 / 12,310 / + [in contig]
Location11162..12310 [in whole cluster]
11162..12310 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)ChaGT1 protein
Gene
Gene (GenBank)chaGT1
EC number
Keyword
  • D-fucose
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q70J67
NITE
Chro_00310
PmId
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)
ACC
Q9L9F5
PmId
[12680772] Initial characterization of novobiocic acid noviosyl transferase activity of NovM in biosynthesis of the antibiotic novobiocin. (Biochemistry. , 2003)

close this sectionSequence

selected fasta
>putative glycosyltransferase [ChaGT1 protein]
MRILVTTAPSPGHFFPLVPFAWALRARGHQVLVTMPEQFIAEAGRSGLPAVASVPPIDLR
AAMDSGEGPHPSQREGARDASVEHIGRGFGRLSELTVEGTVAVAERWVPDLVVSEPTEHA
GAVAAAHRGVPLLRHNWGLELPPETEEIAADQMAPTLARLGLPAPAKAGLRVDICPESLQ
RPQARPAQRMRFVPYSGAGVTPPWLLEEPDRPRVCVTLGSVVPMIHGVKVLKELGEELSG
DDMETVIAVPDRFADELGALPPGVRAAAWLPLGLLLTHCTAVVHHGGIGTALTALAFGLP
QVALPHMGDQHATADRLAAAGAAAVVRREDITPAAVAEALRRVRSEPGYAEGARALRAEN
TAAPGLDEVACLAEQLAGAHRK
selected fasta
>putative glycosyltransferase [ChaGT1 protein]
ATGCGCATCCTGGTCACCACCGCCCCGAGCCCGGGGCACTTCTTCCCACTCGTCCCCTTC
GCCTGGGCGCTGCGTGCCCGTGGGCACCAAGTCCTGGTCACCATGCCCGAGCAGTTCATC
GCCGAGGCCGGCCGGTCCGGTCTCCCCGCGGTGGCCTCGGTGCCGCCGATCGACCTGCGC
GCCGCGATGGACTCGGGGGAGGGACCGCACCCGTCGCAGCGCGAGGGGGCCCGGGACGCC
TCCGTGGAGCACATCGGCAGAGGCTTCGGCCGACTGTCGGAGCTGACCGTCGAGGGCACC
GTCGCGGTCGCTGAACGGTGGGTGCCCGACCTCGTCGTGTCGGAGCCGACCGAGCACGCC
GGGGCGGTCGCCGCGGCCCACCGCGGGGTTCCGCTGCTCCGGCACAACTGGGGGCTCGAA
CTGCCCCCGGAGACGGAGGAGATCGCCGCGGACCAGATGGCGCCCACCCTCGCCCGCCTC
GGCCTGCCCGCGCCGGCGAAGGCCGGACTGCGGGTCGACATCTGCCCGGAGAGCCTCCAG
CGGCCGCAGGCACGACCGGCGCAGCGGATGCGGTTCGTGCCCTACAGCGGGGCCGGCGTC
ACACCGCCCTGGTTGCTGGAAGAGCCCGACCGCCCCCGGGTCTGCGTGACGCTCGGCAGC
GTCGTGCCGATGATCCACGGCGTGAAGGTCCTCAAGGAACTGGGGGAGGAACTCTCCGGC
GACGACATGGAGACCGTCATCGCCGTTCCCGACCGCTTCGCCGACGAACTCGGCGCGCTT
CCCCCGGGAGTGCGGGCGGCCGCCTGGCTGCCGCTCGGTCTTCTCCTCACCCACTGCACG
GCGGTCGTGCACCACGGCGGGATCGGCACCGCGCTGACCGCCCTGGCCTTCGGACTGCCC
CAGGTCGCCCTGCCCCACATGGGCGACCAGCACGCCACCGCCGATCGTCTCGCGGCGGCC
GGAGCGGCGGCGGTCGTACGTCGCGAGGACATCACTCCCGCCGCCGTGGCCGAGGCCCTG
CGCCGGGTCCGCAGCGAGCCGGGATACGCGGAGGGCGCCCGCGCGCTGAGGGCGGAGAAC
ACCGCGGCGCCCGGTCTCGACGAAGTCGCGTGCCTCGCCGAGCAGTTGGCTGGCGCCCAC
CGGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-136]  1.5e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-265]  2.4e-25 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.519 Signal
Bacteria, Gram-positive   
 [1-28]  0.85 Signal
Eukaryota   
TMHMM No significant hit