close all open/close all

CDS information : Chart_00140


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction12,516 / 13,574 / + [in whole cluster]
12,516 / 13,574 / + [in contig]
Location12516..13574 [in whole cluster]
12516..13574 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)ChaS1 protein
Gene
Gene (GenBank)chaS1
EC number2.7.7.24
Keyword
  • D-fucose
  • D-digitalose
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9ZGC8
NITE
Lando_00120
PmId
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [ChaS1 protein]
MKALVLAGGMGIRLRPLSHTTAKQLIPVGGEPVVRYSLDVIREAGITEVGIVVGERGDQF
RRILGDGRDMGLRITYIEQERPDGLAHCVLIAREFLGSDDFLMCLGDNVVLEGVGQLVSE
FRSNRADAMLLLGKVDDPSEYGVAVVDDAGRIQRLVEKPETYVGDLAVVGAYVFSSAIHR
AVRAIRPSARGELEITEAIQWLVDTGRRVVGHECPGYWKDAGRLADLLACNRVLLERLTT
DITGQVDEASTIRGPVVVAENATVSGSELVGPVLVAAGAVVRDSKLGPHTAVGPGCRITE
AEIADSILLEDATVHGVSGLSGSVVGRAASVRGGGAGAEVFLGDDSSVVIAS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [ChaS1 protein]
GTGAAGGCATTGGTTCTCGCCGGGGGAATGGGAATCCGGCTGCGCCCGTTGAGCCACACC
ACCGCGAAACAACTGATACCGGTCGGCGGTGAACCCGTGGTCCGCTACAGTCTCGACGTC
ATTCGCGAGGCCGGGATCACCGAGGTCGGAATCGTCGTGGGAGAACGCGGCGACCAGTTC
CGCAGAATTCTGGGTGACGGCCGTGACATGGGTCTGCGCATCACCTACATCGAACAGGAA
CGACCGGACGGACTGGCCCATTGCGTGCTGATCGCCCGGGAATTCCTCGGATCCGACGAC
TTCCTCATGTGCCTCGGCGACAACGTCGTACTGGAAGGCGTCGGTCAACTCGTCTCGGAG
TTCCGCTCGAACCGTGCCGACGCGATGCTTCTGCTGGGGAAGGTCGACGACCCGTCGGAG
TACGGCGTCGCCGTGGTCGACGACGCCGGACGCATCCAGCGACTGGTGGAGAAGCCCGAG
ACCTACGTCGGCGATCTCGCCGTCGTCGGCGCCTACGTGTTCTCATCGGCGATCCACCGG
GCGGTGCGGGCGATCAGGCCGAGCGCCCGGGGCGAGCTGGAGATCACCGAAGCGATCCAG
TGGCTCGTCGACACCGGCCGGCGCGTGGTCGGTCACGAGTGCCCGGGCTACTGGAAGGAC
GCCGGGCGCCTCGCCGATCTGCTCGCCTGCAACCGTGTCCTGCTGGAACGGCTGACCACG
GACATCACCGGTCAGGTCGACGAGGCGTCGACCATCCGCGGTCCGGTGGTCGTGGCGGAG
AACGCCACCGTCAGCGGATCCGAACTCGTGGGCCCCGTACTGGTGGCGGCCGGCGCCGTG
GTGCGGGACAGCAAGCTGGGGCCGCACACCGCCGTCGGCCCCGGCTGCCGCATCACCGAG
GCCGAGATAGCCGACTCGATCCTGCTGGAGGACGCCACCGTCCACGGCGTCAGTGGGTTG
TCGGGCTCGGTCGTGGGCCGTGCGGCCAGCGTCCGGGGCGGCGGGGCCGGGGCCGAAGTG
TTCCTCGGTGACGACAGCAGCGTGGTGATCGCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  1e-50 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-348]  2.59999999999995e-111 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit