close all open/close all

CDS information : Chart_00150


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction13,571 / 14,503 / + [in whole cluster]
13,571 / 14,503 / + [in contig]
Location13571..14503 [in whole cluster]
13571..14503 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)ChaS4 protein
Gene
Gene (GenBank)chaS4
EC number
Keyword
  • D-fucose
  • D-digitalose
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q331Q7
PmId
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)
ACC
A2BD24
PmId
[17202151] The dTDP-4-dehydro-6-deoxyglucose reductase encoding fcd gene is part of the surface layer glycoprotein glycosylation gene cluster of Geobacillus tepidamans GS5-97T. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [ChaS4 protein]
MSGPGKDPDRATPTRRPALVVGAGGLMGRALCQRLRASGAEAVAATRDTPPLVRPDGTPA
PALRAAGVVHYLATSVTPGLAETHPERVAADHETFVRTLDALATVEKPPLVVLASTGLTV
SESGDGRPCTEDAEALPKSAYARAKLALERELLYRSPLVPGMVVRMTNVYGPGHALRRGY
GVVAHWLAAVAQGRPLELYGDPDTTRDYLYVDDAVAALAGLGPEAADLPFDVVNIGSGEA
TTLGRLLGVVREVTDRELTVRLRPGRGFDQPANLLDVDRAHRRLGWRARTPLAVGLERTW
RALNGTAVAP
selected fasta
>putative NDP-hexose C-4 ketoreductase [ChaS4 protein]
ATGAGCGGGCCGGGAAAGGATCCGGACCGGGCAACGCCCACGCGGCGGCCCGCCCTGGTT
GTCGGTGCGGGCGGACTCATGGGCCGGGCACTGTGCCAGCGGCTGCGCGCGAGCGGAGCC
GAGGCCGTCGCCGCCACGCGCGACACACCCCCGCTGGTCCGGCCCGACGGAACCCCCGCC
CCGGCGCTGCGCGCCGCGGGCGTCGTCCACTACCTCGCGACGAGCGTGACCCCGGGCCTC
GCCGAGACCCACCCCGAGCGCGTAGCCGCAGACCACGAGACGTTCGTACGGACTCTGGAC
GCACTCGCGACCGTCGAGAAGCCGCCGTTGGTCGTGCTGGCCAGCACCGGCCTGACGGTC
AGTGAGTCCGGCGACGGCAGGCCGTGCACCGAGGACGCGGAGGCCCTGCCCAAGTCGGCG
TACGCGAGGGCCAAGCTCGCCCTGGAGCGGGAGCTGCTGTACCGCTCGCCGCTCGTGCCG
GGGATGGTCGTGCGGATGACCAACGTGTACGGCCCCGGGCACGCGCTGCGCCGCGGGTAC
GGCGTCGTCGCCCACTGGCTGGCCGCCGTCGCGCAGGGACGTCCGCTGGAGCTGTACGGC
GACCCGGACACCACCCGGGACTACCTCTACGTCGACGACGCGGTGGCCGCACTGGCCGGG
CTCGGCCCGGAAGCGGCCGACCTGCCGTTCGACGTCGTCAACATCGGGTCGGGGGAGGCG
ACCACGCTCGGCCGGCTGCTCGGCGTCGTCCGTGAGGTGACCGACCGGGAGTTGACCGTC
CGGCTGCGGCCCGGCAGGGGGTTCGACCAGCCCGCCAACCTCCTCGACGTCGACCGGGCA
CACCGGCGGCTCGGCTGGCGGGCGCGCACACCGCTCGCCGTGGGCCTGGAACGCACCTGG
CGTGCGCTGAACGGTACGGCGGTGGCCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [18-219]  1.2e-23 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [18-186]  6.19999999999999e-19 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-32]  0.632 Signal
Eukaryota   
 [1-39]  0.415 Signal
Bacteria, Gram-positive   
TMHMM No significant hit