close all open/close all

CDS information : Chart_00160


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction14,766 / 15,086 / + [in whole cluster]
14,766 / 15,086 / + [in contig]
Location14766..15086 [in whole cluster]
14766..15086 [in contig]
TypeCDS
Length321 bp (106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)ChaH protein
Gene
Gene (GenBank)chaH
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>putative C-12 oxygenase [ChaH protein]
MREKPMLVFINRFTVSGDPLEFERAFAETAAHLARQPGFIRYRLVRSTEDPHSYANVAEW
ETAAALREALRGPEFDDHARRLRELARSEPQFYDVVTETDAIRSRR
selected fasta
>putative C-12 oxygenase [ChaH protein]
ATGAGAGAGAAGCCGATGCTCGTCTTCATCAACCGGTTCACCGTCAGCGGCGATCCGCTC
GAGTTCGAGCGCGCCTTCGCCGAGACCGCGGCCCACCTCGCGCGACAGCCGGGGTTCATC
CGGTACCGCCTGGTCCGCTCGACGGAAGACCCGCACTCCTACGCCAACGTGGCCGAATGG
GAGACGGCGGCCGCCCTGCGCGAGGCCTTGCGCGGGCCGGAGTTCGACGACCACGCGCGC
CGGCTGCGTGAGCTGGCGCGCAGCGAGCCACAGTTCTACGACGTGGTCACCGAGACCGAC
GCCATCCGATCGCGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [6-80]  8.1e-22 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [6-102]  2.19999900980708e-21 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-27]  0.135 Signal
Bacteria, Gram-positive   
 [1-17]  0.168 Signal
Eukaryota   
TMHMM No significant hit