close all open/close all

CDS information : Chart_00170


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction15,088 / 16,086 / + [in whole cluster]
15,088 / 16,086 / + [in contig]
Location15088..16086 [in whole cluster]
15088..16086 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)ChaS2 protein
Gene
Gene (GenBank)chaS2
EC number4.2.1.46
Keyword
  • D-fucose
  • D-digitalose
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q7BG47
PmId
[17237178] Functional characterization of the initiation enzyme of S-layer glycoprotein glycan biosynthesis in Geobacillus stearothermophilus NRS 2004/3a. (J Bacteriol. , 2007)
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [ChaS2 protein]
MTRLLVTGGAGFIGANFVHHTLTTRPEFEICVLDALTYAGNRDNLKSVAGDIRFVEGDIC
DTELVDRLVADADLVVHLAAESHVDNSLRDPEPFVRSNVMGTYVLLEAVRRYDRRFHHIS
TDEVFGDLPLDSEEKFTEASPYNPSSPYSATKASSDMLVRAWVRSFGVAATLSNCANNYG
PYQHAEKFIPRQVTNVLTDRLPKLYGSGRNVREWTHVEDHNEAVHLILEKGGIGETYLIG
SGCEMSNKAIVKILLELMGKPVDRYEEILDRPGHDLRYANDSSKLRTRLGWQPRHRSLRS
GLAATIDWYRENPWWWASRKDAVESAYDASGR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [ChaS2 protein]
ATGACGCGCCTGCTCGTGACCGGCGGTGCCGGGTTCATCGGTGCCAACTTCGTGCACCAC
ACGCTGACCACACGACCCGAGTTCGAGATCTGCGTCCTGGACGCGCTGACCTACGCCGGC
AACCGCGACAACCTCAAGTCCGTGGCCGGCGACATCCGCTTCGTCGAAGGCGACATCTGC
GACACGGAACTCGTCGACCGCCTCGTCGCCGACGCCGACCTCGTCGTCCACCTGGCCGCC
GAATCGCACGTCGACAACTCGCTGCGTGACCCCGAACCGTTCGTCCGTAGCAACGTCATG
GGGACCTACGTCCTGCTGGAGGCCGTGCGCCGGTACGACCGGCGCTTCCATCACATCTCC
ACCGACGAGGTCTTCGGCGACCTCCCGCTCGACTCCGAGGAGAAGTTCACCGAGGCGAGC
CCCTACAACCCGTCGAGCCCCTACTCGGCGACCAAGGCGAGCTCCGACATGCTGGTCCGG
GCATGGGTGCGCTCCTTCGGGGTGGCGGCGACGCTGTCGAACTGCGCCAACAATTACGGG
CCCTATCAGCACGCGGAGAAATTCATCCCGCGTCAGGTCACCAACGTCCTCACCGACCGG
CTGCCGAAGCTGTACGGGAGCGGCCGCAACGTCCGGGAATGGACGCATGTCGAGGACCAC
AACGAGGCCGTCCATCTCATCCTGGAAAAGGGCGGGATCGGCGAGACCTATCTCATCGGA
TCCGGTTGCGAGATGAGCAACAAAGCGATTGTAAAAATACTCCTCGAACTCATGGGAAAA
CCGGTGGACCGGTATGAGGAGATCCTCGACAGACCGGGCCACGATCTTCGTTATGCGAAC
GACTCGTCGAAGCTGCGGACCCGGCTCGGCTGGCAGCCGCGTCATCGGAGCCTTCGCTCC
GGGCTCGCCGCGACCATCGACTGGTATCGAGAAAACCCCTGGTGGTGGGCGTCGCGCAAG
GACGCCGTCGAGAGCGCGTACGACGCATCGGGCAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-240]  2.99999999999998e-64 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-317]  TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [2-188]  5.89999999999994e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-23]  0.59 Signal
Eukaryota   
TMHMM No significant hit