close all open/close all

CDS information : Chart_00180


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction16,264 / 17,577 / + [in whole cluster]
16,264 / 17,577 / + [in contig]
Location16264..17577 [in whole cluster]
16264..17577 [in contig]
TypeCDS
Length1,314 bp (437 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChaR2 protein
Gene
Gene (GenBank)chaR2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [ChaR2 protein]
MTVHETSSLLASCLTRLRWSPEHLALEINKKCGAGTISKKAPYNWLKGARPRRHLPHVVA
EILADRLGEPITVEALWPGSTPTNRVLGRAARIQTVSSVPSLPVAMADLTNVAVAWLVED
EPALPVRLYGDEVPEVAIQMLSARLQQLRKVDEISSTRLAMDWALQDLQLARKLAADHAY
DEPTGVQLHRLIAELAQLAGWLAAELGLLRLARSCLLTGLAAARIARDRSLAAYILSGMS
YRSIWEGEPEAGLRLIRIARKGTDRDDRGIHQALLATREARVRAALGDRAGCEHAIAEAA
ELSLDAEPASAKPWVQWVNRAVILADAGRSWLELGCFRRAESYLAHGLALFGDCQPRNRM
LHAASLAEARLGRDEIDGAAEAAEEALSLAGVMVSQRARVRLSGLRRQFLRNDPAIARET
SRRIAEFLSRDRLLQES
selected fasta
>hypothetical protein [ChaR2 protein]
ATGACCGTCCATGAGACGTCTTCATTGCTCGCCTCGTGCTTGACCAGACTTCGCTGGTCT
CCGGAGCATTTGGCCCTGGAGATCAACAAGAAGTGCGGAGCGGGAACAATCAGCAAAAAG
GCCCCTTACAATTGGTTGAAAGGGGCACGACCTCGTCGGCATTTGCCTCATGTGGTGGCC
GAGATCCTCGCCGACCGACTGGGCGAGCCGATCACGGTGGAGGCACTGTGGCCCGGGTCC
ACGCCGACGAACCGGGTGCTGGGCCGGGCCGCCCGCATCCAGACCGTGTCCTCCGTTCCG
AGCCTGCCGGTGGCGATGGCCGATCTGACCAATGTGGCTGTCGCCTGGCTGGTGGAGGAC
GAGCCGGCGCTTCCCGTCCGGCTGTATGGGGACGAAGTACCGGAAGTGGCGATCCAGATG
CTGTCCGCCCGCCTCCAGCAACTGCGCAAGGTGGACGAGATCTCCAGCACCAGACTCGCC
ATGGACTGGGCACTCCAGGATCTGCAACTCGCGCGCAAACTGGCCGCGGACCACGCCTAC
GACGAACCGACCGGTGTACAACTGCACCGCCTCATCGCCGAACTGGCACAGCTGGCCGGC
TGGCTCGCCGCCGAACTGGGACTGCTCCGCCTCGCCCGGTCCTGCCTGCTGACCGGGCTC
GCCGCGGCCCGTATCGCCCGGGATCGCTCACTGGCCGCGTACATCCTCTCCGGCATGAGC
TACCGGTCGATCTGGGAAGGCGAGCCGGAGGCCGGGCTGCGGCTCATCCGTATCGCACGC
AAGGGAACGGACCGCGACGACCGCGGCATCCACCAGGCGCTGCTGGCGACCCGCGAGGCA
CGGGTCCGTGCGGCTCTCGGCGACCGGGCGGGTTGCGAGCACGCCATCGCGGAGGCGGCG
GAACTGAGCCTCGATGCCGAACCGGCGTCAGCGAAGCCGTGGGTCCAGTGGGTGAACCGG
GCCGTCATCCTCGCCGACGCCGGCCGGTCCTGGCTGGAGCTCGGGTGCTTTCGACGGGCC
GAGAGCTATCTGGCCCACGGGCTCGCACTGTTCGGTGACTGCCAGCCCCGCAACCGGATG
CTGCACGCCGCCTCGCTGGCCGAGGCCCGGCTCGGCCGCGACGAGATAGACGGAGCCGCC
GAGGCCGCCGAGGAAGCGCTGTCGCTGGCCGGGGTGATGGTCTCCCAGCGCGCCCGCGTC
CGGCTCTCGGGGCTGCGCCGGCAGTTCCTGCGCAACGACCCCGCGATCGCCCGGGAGACC
TCCCGGAGGATCGCCGAGTTCCTGTCCAGGGACCGATTACTGCAGGAGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit