close all open/close all

CDS information : Chart_00190


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction18,082 / 17,690 / - [in whole cluster]
18,082 / 17,690 / - [in contig]
Locationcomplement(17690..18082) [in whole cluster]
complement(17690..18082) [in contig]
TypeCDS
Length393 bp (130 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ChaP protein
Gene
Gene (GenBank)chaP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [ChaP protein]
MAVELNHTIVLVKDKDASATFMADLLGLPKPKEMGPFAVLQLANDVSIDFMDFRGEGDIV
PGHCAFLISDEEFDQIFGRIREGGIEHWADQYHREPGRINDRDGGRGVYFEDPSGHNMEI
MTRPYGSGGA
selected fasta
>hypothetical protein [ChaP protein]
ATGGCCGTGGAACTGAACCACACCATCGTTCTGGTGAAGGACAAGGACGCCTCGGCAACG
TTCATGGCCGACCTTCTCGGCCTGCCGAAGCCGAAGGAGATGGGCCCGTTCGCGGTACTG
CAACTCGCCAACGACGTGTCGATCGACTTCATGGACTTCCGGGGCGAGGGTGACATAGTT
CCGGGACACTGCGCATTCCTGATCAGCGACGAGGAGTTCGACCAGATCTTCGGACGCATT
CGCGAGGGCGGCATCGAGCACTGGGCGGACCAGTACCACCGGGAGCCCGGCCGGATCAAC
GACCGTGACGGTGGGCGCGGGGTCTACTTCGAGGATCCGAGCGGGCACAACATGGAGATC
ATGACCCGGCCCTACGGCAGCGGCGGGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018146 Glyoxalase I, conserved site (Conserved_site)
 [7-28]  PS00934
PS00934   GLYOXALASE_I_1
IPR025870 Glyoxalase-like domain (Domain)
 [12-121]  3.8e-10 PF12681
PF12681   Glyoxalase_2
SignalP No significant hit
TMHMM No significant hit