close all open/close all

CDS information : Chart_00200


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction18,547 / 18,098 / - [in whole cluster]
18,547 / 18,098 / - [in contig]
Locationcomplement(18098..18547) [in whole cluster]
complement(18098..18547) [in contig]
TypeCDS
Length450 bp (149 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)ChaU protein
Gene
Gene (GenBank)chaU
EC number
Keyword
  • two-component system
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q1XDX7
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
ACC
Q9RN64
NITE
Nogl_00150
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative hydroxylase [ChaU protein]
MTAADNKKRCLEMVDAWNRGELGGVTAHWSPDVVHHSEERIVPNEEMVLRMESGLTAFPD
VRLDVRSVLAEDDRVSMRISVTATHTGPFMDIAPTNRTVTWHTAEEFRFVDGKVVEHWDV
INYMPMLRELNMVGSDVRGWGTAEQQVSR
selected fasta
>putative hydroxylase [ChaU protein]
TTGACTGCGGCCGACAACAAGAAGCGCTGTCTCGAGATGGTCGACGCATGGAATCGCGGG
GAGCTCGGCGGAGTGACGGCGCACTGGTCACCGGACGTCGTCCATCACTCCGAGGAAAGG
ATCGTGCCGAACGAGGAAATGGTCCTCCGCATGGAATCCGGCCTGACGGCTTTTCCCGAT
GTGCGTCTCGACGTCAGGAGTGTGCTGGCCGAGGACGATCGGGTCAGCATGCGGATCAGT
GTCACCGCCACACACACGGGCCCGTTCATGGACATCGCTCCGACGAACCGGACGGTGACC
TGGCACACCGCGGAGGAATTCCGCTTCGTCGACGGCAAGGTCGTCGAGCACTGGGATGTC
ATCAACTACATGCCGATGCTGCGGGAGTTGAACATGGTCGGCTCCGACGTGCGCGGCTGG
GGGACGGCCGAGCAGCAGGTCTCCCGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [13-130]  9.7e-33 PF07366
PF07366   SnoaL
SignalP No significant hit
TMHMM No significant hit