close all open/close all

CDS information : Chart_00215


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction18,677 / 19,348 / + [in whole cluster]
18,677 / 19,348 / + [in contig]
Location18677..19348 [in whole cluster]
18677..19348 [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NAD(P)H--quinone oxidoreductase
Product (GenBank)
GenechaX
Gene (GenBank)
EC number
Keyword
  • two-component system
  • hydroxylate
Note
Note (GenBank)
Reference
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9RN62
NITE
Nogl_00170
PmId
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative NAD(P)H--quinone oxidoreductase
MTYLVTGASGHVGREVTRQLAAAGHEVRAMTRTPGRTPAPDDVEVVAGDLTRPDSLDEAL
RGIERMYLFPVPETASEVVARAVRAGVRRIVVLSSSSVHDETTHSGAHHRAVERAVEDSG
VEWTFVRPDEFANNLLWKWGHSIRAEGVVRAPYPEARRALIHERDVAAVAAAALMTDGHA
GARYELTGPELLDQPEQVARIAGVTGTGIRFEEVTPRGRAGGE
selected fasta
>putative NAD(P)H--quinone oxidoreductase
ATGACGTATCTGGTGACCGGCGCGTCAGGACACGTCGGCAGAGAGGTGACACGGCAATTG
GCGGCGGCGGGGCACGAAGTGCGGGCGATGACCCGTACCCCGGGGCGGACCCCCGCCCCC
GACGACGTAGAGGTCGTCGCCGGCGACCTGACCCGGCCGGACAGCCTGGACGAGGCGTTG
CGGGGGATCGAGCGGATGTATCTGTTCCCGGTGCCGGAGACGGCGTCCGAAGTCGTCGCA
CGGGCGGTGCGGGCCGGCGTGCGCCGCATCGTGGTGCTGTCGTCCAGCTCGGTGCACGAC
GAGACCACCCACAGCGGGGCCCACCACCGGGCAGTGGAACGCGCCGTCGAGGACAGCGGC
GTCGAGTGGACCTTCGTACGGCCCGACGAGTTCGCCAACAACCTGCTGTGGAAGTGGGGG
CACTCGATCCGCGCCGAGGGCGTGGTCCGTGCTCCGTATCCCGAGGCCCGGCGCGCGCTG
ATCCACGAGAGGGACGTGGCGGCGGTGGCGGCCGCGGCCCTGATGACGGACGGTCACGCC
GGCGCCCGCTACGAGCTGACCGGACCAGAACTGCTGGACCAGCCGGAGCAGGTCGCCCGT
ATCGCCGGGGTCACGGGCACCGGCATCCGCTTCGAGGAGGTGACCCCGCGGGGCCGCGCG
GGAGGAGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-190]  1.4e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit