close all open/close all

CDS information : Chart_00220


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction20,845 / 20,402 / - [in whole cluster]
1,265 / 822 / - [in contig]
Locationcomplement(20402..20845) [in whole cluster]
complement(822..1265) [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)ChaK protein
Gene
Gene (GenBank)chaK
EC number
Keyword
  • 4th ring
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q54808
NITE
Adria_00320
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[10200167] DnrD cyclase involved in the biosynthesis of doxorubicin: purification and characterization of the recombinant enzyme. (Biochemistry. , 1999)
ACC
Q55215
NITE
Dauno_00090
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
ACC
Q9RN59
NITE
Nogl_00200
PmId
[10639368] Identification of a cyclase gene dictating the C-9 stereochemistry of anthracyclines from Streptomyces nogalater. (Antimicrob Agents Chemother. , 2000)
[15071504] Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation. (EMBO J. , 2004)
[16414075] Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity. (J Mol Biol. , 2006)
ACC
O52646
NITE
Acla_00130
PmId
[10658662] Elucidation of anthracyclinone biosynthesis by stepwise cloning of genes for anthracyclines from three different Streptomyces spp. (Microbiology. , 2000)
[16414075] Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity. (J Mol Biol. , 2006)

close this sectionSequence

selected fasta
>putative cyclase [ChaK protein]
MSSNVDVVRRMVRAYNTGDTSDVDQYIHPDYLNPASLEHMADKNWRGPAVFAMAVKWLRA
TFSEEVRLEEIRYEERGDWVRAYLALYGRHVGELVGMPATGRRFSGEQIHLIKLVDGRIR
DHRDWPDYLGTYRQLDEPWPTAAGWRD
selected fasta
>putative cyclase [ChaK protein]
GTGAGCAGCAACGTCGATGTCGTACGGAGGATGGTGCGCGCCTACAACACCGGCGACACC
AGTGATGTGGACCAGTACATTCACCCCGACTATCTGAACCCCGCCTCCCTGGAGCACATG
GCGGACAAGAACTGGCGCGGACCGGCCGTCTTCGCGATGGCGGTGAAGTGGCTGCGGGCG
ACCTTCTCCGAGGAGGTGCGCCTGGAGGAGATCCGGTACGAGGAGCGCGGCGACTGGGTG
CGCGCCTATCTGGCCCTGTACGGCCGCCATGTCGGCGAACTGGTGGGGATGCCCGCGACG
GGCCGTCGTTTCTCCGGGGAGCAGATCCATCTGATCAAGCTGGTCGACGGCAGGATCCGG
GACCACCGTGACTGGCCGGACTATCTCGGCACGTACCGGCAGCTCGACGAGCCGTGGCCG
ACCGCGGCGGGCTGGCGGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [8-122]  6.2e-15 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit