close all open/close all

CDS information : Chart_00230


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction21,638 / 20,898 / - [in whole cluster]
2,058 / 1,318 / - [in contig]
Locationcomplement(20898..21638) [in whole cluster]
complement(1318..2058) [in contig]
TypeCDS
Length741 bp (246 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-7 ketoreductase
Product (GenBank)ChaL protein
Gene
Gene (GenBank)chaL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative C-7 ketoreductase [ChaL protein]
MRGIVITGGGTGIGRAAAHAFADAGDAVLIVGRSADTLAETAKGRDGIHTLPLDLTEPDA
AAVVVETARRQLGRLDVLVNNAGIASFAGLGSLEPASVEAQIRTNLIAPILLTQQALDSL
EETRGLVVNISSAGSIGLRTIPDNSVYCATKAGLDVLTRTWSVELAPRGIRVIGVAPGVT
DTGVALRAGVSPAQYEAFMERMRAEIPLGRVGAPEDIAWWIVTLASADGGYLNGAVIPVD
GALSVT
selected fasta
>putative C-7 ketoreductase [ChaL protein]
ATGCGAGGAATCGTCATCACCGGCGGCGGCACGGGCATCGGCCGTGCCGCCGCGCACGCT
TTCGCCGACGCCGGCGACGCGGTCCTGATCGTCGGGCGGTCGGCGGACACGCTCGCCGAG
ACCGCGAAGGGCCGGGACGGCATCCACACCCTCCCGCTCGACCTGACCGAGCCGGACGCG
GCGGCCGTCGTCGTCGAAACCGCTCGACGTCAGCTCGGGCGGCTCGACGTGCTCGTCAAC
AACGCCGGGATCGCGAGCTTCGCCGGCCTCGGCTCGCTGGAACCGGCCTCGGTCGAGGCG
CAGATCAGGACCAATCTGATCGCGCCGATCCTGCTCACCCAACAGGCCCTGGACTCGCTG
GAGGAGACCCGCGGTCTCGTCGTCAACATCAGTTCGGCCGGGTCGATCGGGCTGCGCACC
ATCCCGGACAACTCGGTGTACTGCGCCACGAAGGCGGGCCTGGACGTGCTCACCCGCACC
TGGTCCGTCGAGCTGGCCCCGCGCGGCATCCGGGTCATCGGCGTCGCGCCGGGTGTCACC
GACACCGGTGTGGCGCTGCGGGCCGGTGTGTCCCCGGCCCAGTACGAGGCGTTCATGGAG
CGGATGCGGGCGGAGATCCCGCTCGGCCGGGTCGGTGCTCCGGAGGACATCGCCTGGTGG
ATCGTCACGCTGGCCTCGGCGGACGGGGGGTACCTCAACGGCGCGGTGATACCGGTGGAC
GGCGCGCTGTCGGTCACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [73-84]  1.09999909120787e-11 PR00080 [125-133]  1.09999909120787e-11 PR00080 [147-166]  1.09999909120787e-11 PR00080
PR00080   SDRFAMILY
 [4-165]  3.8e-28 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [3-20]  7.40000780398342e-37 PR00081 [73-84]  7.40000780398342e-37 PR00081 [119-135]  7.40000780398342e-37 PR00081 [147-166]  7.40000780398342e-37 PR00081 [168-185]  7.40000780398342e-37 PR00081 [207-227]  7.40000780398342e-37 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-245]  1.9e-70 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-20]  0.805 Signal
Bacteria, Gram-negative   
TMHMM No significant hit