close all open/close all

CDS information : Chart_00245


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction22,642 / 23,829 / + [in whole cluster]
3,062 / 4,249 / + [in contig]
Location22642..23829 [in whole cluster]
3062..4249 [in contig]
TypeCDS
Length1,188 bp (395 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)
GenechaZ
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Family/Domain
FD
IPR002938, IPR003042

close this sectionSequence

selected fasta
>putative oxidoreductase
MANVAVIGAGTGGLCLAQALHAAGIEVTVHERHRTPTGALHGYRVRINPTGARALRRCLP
AQVWETFLSRAGRIGQEFGFLTERLRELAVLDGGPDAEPHYSAERGMLREVLLTGLEDVV
RFGACFERYERTQDGRFECHFADGTSTTADLVVGADGANSRVRAQYLPHARRVDIGMVSI
VGRLALPVAEQLLPERLSSRPNSVVAPGGTGMFVARHEPGTDEGYLMWAYGAGAHRYPAD
VETLPGDQLAELVDGLTGSWHPALRAMVRETDPGTVNAVPIRTSVPPDPWPATRVTLLGD
AIHSMTPLRGVGANMALNDAALLARELTGSADTRLAVSRYEDAMRRDGFRAVSESLRAAR
MFVSESTTQRLLFKTVLRTASAVPPLRKALFAKLA
selected fasta
>putative oxidoreductase
ATGGCGAACGTCGCGGTGATCGGCGCGGGGACGGGCGGACTCTGCCTGGCCCAGGCACTC
CACGCGGCCGGCATCGAGGTGACCGTCCATGAACGGCACCGCACCCCGACCGGCGCGCTG
CACGGCTACCGGGTCCGCATCAATCCGACCGGAGCCCGTGCCCTGCGTCGTTGCCTGCCC
GCCCAGGTGTGGGAGACGTTCCTGTCCCGGGCCGGGCGGATCGGGCAGGAATTCGGATTC
CTCACCGAACGACTGAGGGAACTCGCCGTCCTCGACGGCGGACCGGACGCCGAACCGCAC
TACTCCGCCGAGCGCGGCATGCTGCGGGAGGTCCTGCTGACGGGGCTGGAGGACGTGGTC
CGGTTCGGCGCCTGCTTCGAGAGGTACGAGCGTACCCAGGACGGCCGGTTCGAGTGCCAC
TTCGCCGATGGCACCAGCACCACGGCCGACCTCGTCGTCGGCGCGGACGGCGCCAACTCC
CGTGTCCGCGCCCAGTATCTGCCGCACGCGCGCCGCGTCGACATCGGGATGGTCTCGATC
GTCGGCCGCCTCGCCCTGCCCGTCGCCGAACAACTGCTACCCGAGCGTCTGAGCTCCCGC
CCCAACTCGGTCGTCGCGCCCGGAGGCACGGGGATGTTCGTCGCACGGCACGAGCCCGGC
ACGGACGAGGGGTACCTCATGTGGGCTTACGGCGCCGGAGCACACCGCTATCCCGCGGAC
GTCGAGACCCTGCCCGGCGATCAACTGGCCGAACTGGTCGACGGGTTGACCGGATCCTGG
CACCCCGCACTGCGCGCGATGGTCCGCGAGACCGACCCGGGCACGGTCAACGCGGTGCCC
ATCCGCACCTCGGTTCCCCCGGACCCCTGGCCGGCGACCCGGGTGACCCTCCTCGGCGAC
GCCATCCACAGCATGACGCCACTGCGCGGCGTGGGCGCGAACATGGCACTCAACGACGCC
GCGCTCCTCGCCCGCGAACTCACCGGCAGCGCGGACACGCGCCTGGCCGTGAGCCGGTAC
GAGGACGCGATGCGGCGGGACGGCTTCCGCGCGGTCTCCGAGTCGCTGCGCGCCGCCCGG
ATGTTCGTGTCCGAGAGCACGACACAGCGGCTGCTGTTCAAGACGGTGCTCCGGACCGCA
TCCGCCGTACCCCCGCTCCGCAAGGCATTGTTCGCCAAGCTCGCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [147-332]  5.2e-13 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [3-25]  7.7e-21 PR00420 [148-163]  7.7e-21 PR00420 [292-307]  7.7e-21 PR00420 [307-323]  7.7e-21 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-22]  0.975 Signal
Eukaryota   
 [1-22]  0.996 Signal
Bacteria, Gram-negative   
 [1-22]  0.897 Signal
Bacteria, Gram-positive   
TMHMM No significant hit