close all open/close all

CDS information : Chart_00250


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction24,846 / 23,986 / - [in whole cluster]
5,266 / 4,406 / - [in contig]
Locationcomplement(23986..24846) [in whole cluster]
complement(4406..5266) [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)ChaI protein
Gene
Gene (GenBank)chaI
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q54818
NITE
Adria_00310
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative O-methyltransferase [ChaI protein]
MDSTAYKSGVTNAFKNAADSYDRGGVGFFTPMGRRLVELAAPQPGERVLDVGCGRGAALF
PAARAVGPTGRAVGIDIADTMIEAARAEAARAGAENVELLVMDAERPSFARHSFELVLGS
YSILFLPDAPAALARYPRIMTAGGRLAFTCPVFEADSFPFLPPVFTPMIPASVPAALPAD
WQPSELRRRYNSWLSDVELLRATLGEAGFTDVTVRDEAVPMTAESPAAWVDWSHTQGMRL
LWERLPEPVAGELRDSLIAGLSELSGPDGSLVIETPVRFVTARVGS
selected fasta
>putative O-methyltransferase [ChaI protein]
ATGGATTCGACTGCCTACAAGTCCGGGGTGACGAACGCCTTCAAGAACGCCGCCGATTCC
TACGACAGGGGCGGGGTGGGTTTCTTCACCCCCATGGGCCGCCGTCTGGTCGAACTCGCG
GCGCCGCAGCCGGGTGAGCGGGTGCTCGACGTCGGCTGTGGCCGGGGGGCCGCCCTGTTC
CCGGCCGCGCGGGCCGTCGGGCCCACGGGGCGCGCCGTCGGCATCGACATCGCCGACACC
ATGATCGAGGCCGCGCGGGCCGAGGCGGCGCGGGCCGGCGCCGAGAACGTGGAGCTGCTG
GTCATGGACGCCGAGCGTCCGAGCTTCGCGCGTCACTCGTTCGAACTCGTTCTCGGCAGC
TACAGCATCCTGTTCCTGCCCGACGCGCCTGCGGCGTTGGCCCGTTACCCGCGCATCATG
ACGGCCGGGGGCAGGCTCGCCTTCACCTGCCCCGTGTTCGAGGCGGACAGCTTCCCGTTC
CTGCCGCCGGTGTTCACCCCGATGATCCCGGCGTCGGTGCCCGCGGCCCTGCCCGCCGAC
TGGCAGCCGAGCGAGCTGCGCCGTCGCTACAACAGCTGGCTGTCGGACGTCGAGCTGCTC
CGAGCGACCCTCGGCGAGGCCGGGTTCACCGACGTGACCGTACGGGACGAGGCCGTTCCC
ATGACCGCGGAGTCACCGGCCGCGTGGGTCGACTGGTCGCACACGCAGGGCATGCGGCTG
CTGTGGGAGCGGCTTCCGGAGCCGGTCGCCGGGGAGTTGCGTGATTCCCTGATCGCCGGG
CTGTCCGAACTGAGCGGTCCCGACGGCTCGTTGGTGATCGAGACTCCGGTGCGGTTCGTC
ACCGCTCGCGTCGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit