close all open/close all

CDS information : Chart_00270


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction25,802 / 27,430 / + [in whole cluster]
6,222 / 7,850 / + [in contig]
Location25802..27430 [in whole cluster]
6222..7850 [in contig]
TypeCDS
Length1,629 bp (542 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)ChaT1 protein
Gene
Gene (GenBank)chaT1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
P46105
NITE
Actino_00140
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)
[17644591] Investigation of transcription repression and small-molecule responsiveness by TetR-like transcription factors using a heterologous Escherichia coli-based assay. (J Bacteriol. , 2007)
[17338074] Initiation of actinorhodin export in Streptomyces coelicolor. (Mol Microbiol. , 2007)
ACC
P39886
PmId
[1592819] Sequence and transcriptional analysis of the Streptomyces glaucescens tcmAR tetracenomycin C resistance and repressor gene loci. (J Bacteriol. , 1992)
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative drug resistance transporter [ChaT1 protein]
MTEVKTAEAPVTQRPWLVLAIMCVGFFMALLDGSIVNIAIPTLIDGLDASYDQVLWIIDG
YMLVFSVLLITTGRLGDIYGYRRLFLIGITLFTVASALCGLSESPDWLLAARVLQGLGGA
LLFPQVISSILTIFPPQLRGRAFGLFGAIVGFAPIVGPVVGGFLLAHLSWRWIFFINVPI
GIVTALLAVRYVPVMRPGRSNSLDLTGVALATAGLTGIVFGLIEGERYDWGTITGPISIA
SVIIAGVVLLVLFVLWQHRRKTDSLMPLALFNARNFSVGNGVGFIFQLGMIAIAFVLVLY
LQTARGYSALETAAVMLPNAILTAVGSTYAGRLSDKFGGKYVLMAGLAMLTVGLLVLVAS
TDAHSDAWSLLPGLIIIGIASGATFAPLQQATMDGVNPQLAGAASGVSNTTRQVGGVLGT
AVLGALLSARINADLPEEAQEQAAQLPSELRDQFLAAADSAGNFSPPSVPSGLSVSEADL
FRRLGDDAFATSFTHAMHVTFLVAAAVLIAATVLCGLFTTPPRAEPAQETAGEEDTRSTS
ED
selected fasta
>putative drug resistance transporter [ChaT1 protein]
GTGACGGAAGTCAAAACGGCGGAAGCCCCGGTCACGCAGCGGCCATGGTTGGTCCTCGCC
ATCATGTGTGTCGGCTTCTTCATGGCGCTGCTCGACGGAAGCATCGTCAATATCGCCATC
CCGACATTGATCGACGGCCTGGACGCGTCCTACGACCAAGTGCTGTGGATCATCGACGGA
TACATGCTGGTCTTCTCGGTACTGCTGATCACCACCGGGCGCCTCGGCGACATCTACGGG
TATCGGCGGCTTTTCCTGATCGGTATCACCCTCTTCACCGTGGCCTCGGCCCTGTGCGGG
CTGTCCGAGTCGCCCGACTGGCTGCTCGCCGCGCGTGTGCTGCAAGGGCTGGGCGGGGCG
CTGCTGTTCCCGCAGGTGATCTCGTCGATCCTGACGATCTTCCCGCCTCAGCTGCGCGGT
CGGGCGTTCGGCCTCTTCGGGGCCATCGTCGGCTTCGCGCCGATCGTCGGCCCGGTCGTC
GGCGGTTTCCTCCTCGCCCACCTCAGCTGGCGCTGGATCTTCTTCATCAACGTCCCGATC
GGCATCGTCACCGCCCTGCTGGCCGTCCGGTACGTCCCGGTCATGCGGCCCGGCCGCAGC
AACAGCCTCGACCTGACCGGCGTCGCCCTGGCCACCGCCGGCCTCACCGGCATCGTCTTC
GGCCTCATCGAGGGCGAGCGCTACGACTGGGGAACCATCACCGGCCCGATCAGCATCGCG
TCCGTCATCATCGCCGGCGTCGTGCTGCTCGTCCTGTTCGTCCTGTGGCAGCACCGCCGC
AAGACCGACTCCCTCATGCCGCTGGCCCTCTTCAACGCCCGTAACTTCTCGGTCGGCAAC
GGCGTCGGCTTCATCTTCCAGCTCGGGATGATCGCCATCGCCTTCGTCCTGGTGCTCTAT
CTCCAGACGGCCCGCGGTTACAGCGCTCTGGAGACCGCCGCGGTCATGCTGCCCAACGCG
ATCCTGACCGCGGTCGGCTCCACCTACGCGGGCCGGCTGTCCGACAAGTTCGGCGGCAAG
TACGTCCTCATGGCCGGCCTCGCCATGCTCACCGTCGGTCTGCTCGTCCTGGTCGCCTCC
ACCGACGCGCACAGCGACGCCTGGAGTCTGCTGCCCGGCCTGATCATCATCGGCATCGCC
AGCGGCGCCACCTTCGCCCCGCTGCAACAGGCCACCATGGACGGCGTGAACCCCCAGTTG
GCGGGTGCGGCCTCGGGCGTCTCCAACACGACCCGCCAGGTGGGCGGCGTCCTCGGCACC
GCCGTACTGGGCGCCCTGCTGTCCGCCCGTATCAACGCCGATCTCCCCGAGGAGGCCCAG
GAACAGGCCGCCCAGCTGCCGTCGGAACTGCGCGACCAATTCCTGGCCGCCGCCGACAGC
GCGGGGAACTTCAGTCCGCCCAGCGTTCCTTCGGGCCTCAGTGTGAGCGAGGCCGACCTG
TTCCGGCGCCTGGGTGACGACGCCTTCGCGACGAGCTTCACCCACGCCATGCACGTCACC
TTCCTGGTCGCGGCCGCAGTGCTCATCGCGGCGACCGTCTTGTGCGGCCTCTTCACGACG
CCGCCGAGGGCGGAACCCGCCCAGGAGACCGCGGGTGAGGAGGACACCCGCAGCACATCC
GAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [21-45]  2.00000075217457e-11 PR01036 [81-103]  2.00000075217457e-11 PR01036 [142-166]  2.00000075217457e-11 PR01036 [410-429]  2.00000075217457e-11 PR01036
PR01036   TCRTETB
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [19-514]  2.90000000000003e-97 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [23-419]  1.09999999999999e-59 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-535]  1.69998802370953e-88 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [18-523]  PS50850
PS50850   MFS
SignalP
 [1-29]  0.483 Signal
Eukaryota   
TMHMM
 [17-39]  Transmembrane (i-o) [54-71]  Transmembrane (o-i) [84-101]  Transmembrane (i-o) [116-138]  Transmembrane (o-i) [145-167]  Transmembrane (i-o) [172-194]  Transmembrane (o-i) [201-223]  Transmembrane (i-o) [233-255]  Transmembrane (o-i) [276-298]  Transmembrane (i-o) [341-360]  Transmembrane (o-i) [367-389]  Transmembrane (i-o) [496-518]  Transmembrane (o-i)
Transmembrane 12